If you are not sure if the website you would like to visit is secure, you can verify it here. Enter the website address of the page and see parts of its content and the thumbnail images on this site. None (if any) dangerous scripts on the referenced page will be executed. Additionally, if the selected site contains subpages, you can verify it (review) in batches containing 5 pages.

site address: messukeskus.com

site title: Messukeskus | Etusivu

Our opinion:

GREEN status (no comments) - no comments
After content analysis of this website we propose the following hashtags:


Proceed to the page?Powered by: Very Tiny URL Shortener at http://vturl.net VeryTinyURL
page from cache
Meta tags:
description=Messukeskus on Suomen suurin ja monipuolisin tapahtumapaikka. Tutustu tapahtumiimme, tiloihimme sekä Messukeskukseen yrityksenä – tervetuloa!;

Headings (most frequently used words):

2018, 2017, ja, 11, 18, easyfairs, 12, tai, 10, on, käsityötä, itse, tehdä, tykkäät, laatua, messukeskus, suomalaista, arvostat, joka, sinulle, kädentaitotapahtuma, elma, 2019, helsinki, goexpo, 2016, messut, vuonna, outletexpo, caravan, päivät, sivulla, kevät, kokous, båt, vene, järjestä, pro, commerce, löydät, sairaanhoitajapäivät, syksy, mesoaja, habitare, show, matka, suurin, sen, kokoontua, kuin, viihdyttää, pimenevät, mieluisampaa, parhammillaan, mikä, valojuovat, illat, odotuksesta, joulun, kynttilät, kertovat, esityksiä, veneilytapahtuma, talutusratsastus, veneilijöille, vesiharrastajille, näyttelyä, kokousta, tuo, suomi, 100, juhlavuoden, tapahtumiinsa, tiloihinsa, ravintoloihinsa, uutta, pohjois, gaala, elämyksiä, nyt, palkitaan, messu, tapahtumaosaamisen, helmet, upeita, tarjoaa, vaalimaan, euroopan, lähipiirillä, ympärille, pitkäaikaisia, tekemään, perheen, huomenna, paljastettavasta, huvista, kosketusetäisyydellä, tule, hevosista, seuraamaan, ratsastuskisoja, tarvikehankintoja, kertomassa, hakemaan, tietoa, tapahtumasta, laajan, osa, kirjon, eri, rotuisia, hevosia, kilpailuita, arvauksesi, käypä, suhteita, kattaukset, kutsu, asiakkaat, ystävät, herkullisen, ruuan, sekä, wanhan, sataman, makasiinijoulubuffet, 21, arvontaan, menun, linkistä, pienimpiä, kävijää, joulunodotusta, sisähuvipuiston, voit, tänään, osallistua, lippujen, herkullista, autokorjaamo, satama, kunto, educa, korjaamo2018, mp, moottoripyöränäyttely, labquality, days, fillari, kuva, kamera, golf, outdoorexpo, contact, ball, sports, horse, fair, forma, gastro, shop, tech, american, car, kevätmessut, forum, day, luomu, farmasian, elämää, eläimiä, ostoksia, tapahtuma, juhla, tunnelmallinen, tapahtumatalo, metsämessut, kädentaito, lemmikki, operatiiviset, hammaslääkäripäivät, workshop, studia, sijoitus, invest, slush, koiramessut, eläinlääkäripäivät, suomen, sisähuvipuisto, lääkäri, optometriapäivät, näe, lähiruoka, lapsimessut, wanha, maatalouskonemessut, love, me, beauty, viini, ruoka, helsingin, kirjamessut, winter, gamexpo, auto, tapahtumat, nordic, chembio, finland, kiinteistö19, finnsec19, teknologia19, messuklubi, meille, uteliaille, varaa, oma, osastosi, security, hupicon, esimies, eläinystäväni, lautasella, testimessu, eme, mamma, mia, musikaali, pulpaper, advanced, engineering, pactec, henkilöstö, cyber, meetings, events, yritys, promoexpo, markkinoinnin, viikko, antiikki, empack, logistics, distribution, finnbuild, kalastajille,

Text of the page (most frequently used words):
2018 (111), 2017 (43), #messukeskus (41), #vuoden (19), elma (17), suomi (16), #kädentaito (14), com (13), #sitten (12), #päivää (12), tai (12), #helsinki (11), joka (10), osa (9), suomalaista (9), myös (9), #laatua (8), 2019 (8), itse (8), http (8), käsityötä (8), tykkäät (8), tehdä (8), kädentaitotapahtuma (8), arvostat (8), sinulle (8), outletexpo (7), 100 (7), mesoaja (7), www (7), easyfairs (7), messukeskuksen (7), tapahtuma (6), lemmikki (6), #juhlavuoden (6), suomen (6), messut (6), kadentaito (6), messu (6), alan (5), elämää (5), eläimiä (5), ostoksia (5), kuuluvat (5), metsä (5), juhla (5), 2016 (5), tapahtumat (5), näytä (5), facebook (5), alkuperäinen (5), julkaisu (5), tuo (5), goexpo (5), huipputapahtumaa (4), johon (4), sivulla (4), tule (4), ovat (4), tapahtumakokonaisuutta (4), eläm (4), palkintogaala (4), löydät (4), https (4), järjestä (4), viisi (4), lisää (4), tapahtumaosaamisen (4), sen (4), vene (4), lisätietoa (3), etusivu (3), vuonna (3), osallistua (3), yrityksille (3), liput (3), osta (3), jokaiseen (3), helsingin (3), habitare (3), palsta (3), kokous (3), näkyy (3), suurin (3), sekä (3), suuri (3), uusi (3), gaala (3), tekemään (3), båt (3), yhteistyökumppani (2), helmet (2), tapahtumia (2), virallinen (2), lokakuu (2), erikoisnäyttelyinä (2), commerce (2), tuomariston (2), teeman (2), kirjamessut (2), tapahtumaansa (2), mukana (2), somistuksena (2), kevätmessut (2), ulospäin (2), nova (2), factor (2), tutustu (2), fazer (2), mainostoimisto (2), juhlavalaistuksena (2), tapahtuman (2), pekka (2), anni (2), uutta (2), kilpailuina (2), toimitusjohtaja (2), valtakunnallinen (2), esimies (2), kokoustamoon (2), marraskuu (2), messukeskukseen (2), osaajat (2), messuaukiolla (2), joulukuu (2), tammikuu (2), tekijät (2), kokoaa (2), caravan (2), kevät (2), maaliskuu (2), sairaanhoitajapäivät (2), pro (2), ratkaisut (2), syyskuu (2), haetaan (2), esittelee (2), messuteko (2), vepsäläinen (2), palkitsee (2), parhaimmiston (2), markkinoinnin (2), ohjelmina (2), suuntaan (2), kuin (2), lue (2), kunniaksi (2), tapahtumasta (2), laajan (2), kirjon (2), eri (2), rotuisia (2), hevosia (2), eilen (2), show (2), syksy (2), hakemaan (2), päivät (2), käypä (2), kertomassa (2), arvauksesi (2), huomenna (2), paljastettavasta (2), huvista (2), elmamessut (2), sisähuvipuiston (2), tietoa (2), tarvikehankintoja (2), tänään (2), pohjois (2), tilaisuus (2), uutishuone (2), blogit (2), tarina (2), messuklubi (2), tekee (2), tulo (2), ohjeet (2), vuotta (2), euroopan (2), ratsastuskisoja (2), veneilytapahtuma (2), tarjoaa (2), upeita (2), elämyksiä (2), veneilijöille (2), vesiharrastajille (2), kalastajille (2), muut (2), seuraamaan (2), voit (2), kilpailuita (2), lippujen (2), arvontaan (2), heti (2), vaalimaan (2), lähipiirillä (2), kokoontua (2), matka (2), mieluisampaa (2), mikä (2), educa (2), parhammillaan (2), odotuksesta (2), joulun (2), kertovat (2), valojuovat (2), kynttilät (2), illat (2), pimenevät (2), sata, yrittäjien, opetusalan, kädenojennuksen, aloittelevien, historiakohteiden, tuomalla, kaikkiin, kokoustilat, makuja, suomalaisia, kokoustamosta, parhaat, sivistystä, retkikohdetta, kulttuurille, oma, varaa, teemana, kanssamme, onnistumaan, oppimista, messujen, pian, kunnioittaa, goexpossa, yritteliäiden, ihmisten, edistänyt, elinkeinoelämää, joukosta, matalan, semifinaali, matkamessuilla, kansallisruoka, julkistavat, ohjelmansa, lähempänä, juhlavuotta, julkistetaan, alussa, tiloihinsa, kevätmessujen, liity, yleiskoristelualue, saa, keväällä, ilmeen, tapahtumiinsa, nähdään, koristellaan, katajanokalla, teemalla, satama, wanha, ympäri, ammattitapahtumiinsa, yritystapahtumia, osallistumiskynnyksen, alueet, kokki, satamassa, wanhassa, ohjelmatarjontaan, startup, ravintoloihinsa, osastosi, huhtikuu, messuklubiin, korjaamo2018, slush, koiramessut, eläinlääkäripäivät, sisähuvipuisto, lääkäri, näe, optometriapäivät, day, workshop, forum, contact, helmikuu, invest, moottoripyöränäyttely, days, labquality, fillari, kamera, kuva, golf, kunto, outdoorexpo, sports, ball, sijoitus, studia, horse, jopa, englanti, venäjä, ruotsi, maaseutumessut, hallia, ravintolaa, tilaa, erilaista, tilaisuudellesi, hammaslääkäripäivät, tapahtumatalo, tunnelmallinen, sydämessä, katajanokan, modernit, miljöö, historiallinen, satamaan, wanhaan, metsämessut, operatiiviset, farmasian, fair, forma, haluatko, gamexpo, logistics, finnbuild, nordic, security, cyber, love, beauty, ruoka, viini, winter, auto, empack, autokorjaamo, maatalouskonemessut, finland, chembio, finnsec19, kiinteistö19, teknologia19, uteliaille, meille, suosikkimessuistasi, irti, enemmän, distribution, antiikki, gastro, testimessu, tech, shop, car, american, valkoisuudelle, luomu, lähiruoka, lapsimessut, hupicon, eläinystäväni, lautasella, eme, toukokuu, viikko, musikaali, mia, mamma, pulpaper, engineering, advanced, pactec, henkilöstö, events, meetings, yritys, promoexpo, uniikille, usein, sinisyydelle, kolme, käynnissä, kategorioihin, haku, avoin, sykähdyttäjä, ohjelma, markkinoija, messutiimi, messuosasto, messuhelmi, kategoriat, finalistia, haastatteluin, mesoajan, valitaan, kategoriaan, illalliskortin, lunastamalla, voi, gaalaan, kutsuvieraana, gaalasta, jännittävästä, upeasta, nauttimaan, mesoajaksi, saakka, nettisivuilla, hakemus, ala, aalto, tuomaristoon, arvovaltaiseen, ideat, uudet, rohkeimmat, kenellä, edustava, tuomaristossa, messukeskusta, sanoo, kehittymässä, mihin, osaajia, pohtimaan, inspiroituu, raati, kun, keskusteluja, säkenöiviä, odotan, tasokkaan, näin, esiin, seuloa, etuoikeus, kategoriassa, pyri, lähetä, professori, 3250, kosketusetäisyydellä, hevosista, esityksiä, helsinkihorsefair, kts, messukeskuksessa, aikaan, samaan, lataa, kävijää, näyttelyä, kokousta, 450, pienimpiä, 040, asiakaspalvelu, twitter, linkedin, youtube, instagram, pinterest, sovellus, yhteystiedot, medialle, palautetta, anna, kysymykset, perheen, viihdyttää, messusäätiö, linkistä, tukee, toteutusta, tapahtumajärjestäjä, halo, businessfm, muassa, muun, kumppaneita, kiinnostuitko, pitkäaikai, joulunodotusta, herkullista, menun, talutusratsastus, kattaukset, makasiinijoulubuffet, sataman, wanhan, ympärille, ruuan, herkullisen, ystävät, asiakkaat, kutsu, suhteita, pitkäaikaisia, yliopiston, hallitusammattilainen, isänmaalle, suomi100, kokousvieraiden, juhlan, sinivalkoisen, loihtii, ikään, niin, vastaava, ravintolapalveluista, viineriherkun, omistetun, juhlalle, leipoo, aikana, kahviloihin, jatkuvasti, sivua, päivitämme, osoitteesta, löytyy, sivun, oman, juhlaohjelmallemme, avanneet, olemme, palkitaan, pöytään, kokoustarjoiluihin, tapahtumista, palveluissa, satavuotiaalle, kunniaa, kokoustila, henkilön, sadan, avautuu, vaihteessa, juhlavalaistuksen, saavat, seinusta, lännenpuoleinen, messuaukio, tiloissa, tulee, juhlavuosi, alueilleen, piha, väriä, sinivalkoista, valoa, viineri, makuinen, vaniljan, mustikan, erikoisherkku, sinivalkoinen, tarjolle, nyt, muista, kauppalehti, osallistuu, aapo, hurme, noronen, mikko, sipilä, lauri, wallo, helena, asiakaskuntaa, edustajia, messutoimijoiden, suomalaisten, työskentelyyn, jenny, lisäksi, faustuksesta, puhuja, kouluttaja, stä, brandworxx, konsultti, business, radiokanava, perustaja, halon, option, hollanti, jännäri, täysin, vaikuttavuutta, poikkeaa, ansiosta, tämän, toteuttajat, osastojen, tapahtumien, niinkään, kysytyt, edustajat, asiakasyritysten, pääosassa, vahvuutta, messumediaa, anne, erityisesti, esille, välineenä, mediana, tapahtumiin, messuihin, keskittyy, tuomaristo, nimekäs, ratkoo, palkinnot, mattila, korkiakoski, eivät,
Thumbnail images (randomly selected): * Images may be subject to copyright.GREEN status (no comments)
  • https://objects.fi-1.nebu...
  • Kevätpuutarha
  • ulkoalueet_1024x1024
  • Messukeskus-ravintolat
  • https://objects.fi-1.nebu...
  • Mesoaja tunnus
  • Mesoaja hakubanneri
  • https://external.xx.fbcdn...
  • https://external.xx.fbcdn...
  • https://i.ytimg.com/vi/m3...
  • https://i.ytimg.com/vi/jH...
  • https://i.ytimg.com/vi/oa...
  • https://scontent.xx.fbcdn...
  • https://scontent.xx.fbcdn...
  • https://scontent.xx.fbcdn...

Verified site has: 15 subpage(s). Do you want to verify them? Verify pages:

1-5 6-10 11-15


The site also has 55 references to external domain(s).

 twitter.com  Verify  youtube.com  Verify  wanhasatama.com  Verify
 elmamessut.fi  Verify  metsamessut.fi  Verify  kadentaitotapahtuma.fi  Verify
 outletexpo.fi  Verify  lemmikkimessut.fi  Verify  kirurgiyhdistys.fi  Verify
 farmasianpaivat.fi  Verify  hammaslaakaripaivatnayttely.fi  Verify  studiamessut.fi  Verify
 sijoitus-invest.fi  Verify  slush.org  Verify  koiramessut.fi  Verify
 elainlaakaripaivat.fi  Verify  pomppulinnataivas.fi  Verify  laakaripaivatnayttely.fi  Verify
 matkamessut.fi  Verify  contactforum.fi  Verify  caravanmessut.fi  Verify
 mesoaja.fi  Verify  educamessut.fi  Verify  pages.orum.fi  Verify
 mpmessut.fi  Verify  kuvamessut.com  Verify  formakevat.fi  Verify
 gastro.fi  Verify  easyfairs.com  Verify  sairaanhoitajapaivatnayttely.fi  Verify
 fhra.fi  Verify  kevatmessut.fi  Verify  lapsimessut.fi  Verify
 hupicon.fi  Verify  eläinystäväni.fi  Verify  mamma-mia.fi  Verify
 pactec.fi  Verify  promoexpo.fi  Verify  markkinoinninviikko.fi  Verify
 habitare.fi  Verify  antiikkitapahtuma.fi  Verify  finnbuild.fi  Verify
 iloveme.fi  Verify  beautypromessut.fi  Verify  viiniruoka.fi  Verify
 helsinginkirjamessut.fi  Verify  goexpowinter.fi  Verify  gamexpo.fi  Verify
 automessut.com  Verify  autokorjaamomessut.fi  Verify  maatalouskonemessut.fi  Verify
 chembiofinland.fi  Verify  kiinteistomessut.fi  Verify  messuklubi.fi  Verify
 suomifinland100.fi  Verify


Top 50 hastags from of all verified websites.

Supplementary Information (add-on for SEO geeks)*- See more on header.verify-www.com

Header

HTTP/1.1 200 OK
Date Wed, 08 Nov 2017 03:57:29 GMT
Content-Type text/html; charset=UTF-8
Expires Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma no-cache
Link <htt???/messukeskus.com/wp-json/>; rel= htt????/api.w.org/
Link <htt???/messukeskus.com/>; rel=shortlink
X-UA-Compatible IE=Edge
X-Varnish 5665491 3081172
Age 310
Via 1.1 varnish-v4
X-Cache cached
Content-Length 100161
Accept-Ranges bytes

Meta Tags

title="Messukeskus | Etusivu"
charset="utf-8"
http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"
name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=2.0"
name="description" content="Messukeskus on Suomen suurin ja monipuolisin tapahtumapaikka. Tutustu tapahtumiimme, tiloihimme sekä Messukeskukseen yrityksenä – tervetuloa!"
property="og:locale" content="fi_FI"
property="og:type" content="website"
property="og:title" content="Messukeskus | Etusivu"
property="og:description" content="Messukeskus on Suomen suurin ja monipuolisin tapahtumapaikka. Tutustu tapahtumiimme, tiloihimme sekä Messukeskukseen yrityksenä – tervetuloa!"
property="og:url" content="htt???/messukeskus.com/"
property="og:site_name" content="Messukeskus"
property="og:image" content="htt????/objects.fi-1.nebulacloud.fi/messukeskus/wp-content/uploads/2015/12/ccab/7hallinkaari.jpg"
property="og:image:secure_url" content="htt????/objects.fi-1.nebulacloud.fi/messukeskus/wp-content/uploads/2015/12/ccab/7hallinkaari.jpg"
name="twitter:card" content="summary"
name="twitter:description" content="Messukeskus on Suomen suurin ja monipuolisin tapahtumapaikka. Tutustu tapahtumiimme, tiloihimme sekä Messukeskukseen yrityksenä – tervetuloa!"
name="twitter:title" content="Messukeskus | Etusivu"
name="twitter:site" content="@messukeskus"
name="twitter:image" content="htt????/objects.fi-1.nebulacloud.fi/messukeskus/wp-content/uploads/2015/12/ccab/7hallinkaari.jpg"
name="twitter:creator" content="@messukeskus"
name="generator" content="WPML ver:3.7.1 stt:1,18,47,52;"
name="msapplication-TileColor" content="#ffffff"
name="msapplication-TileImage" content="htt???/messukeskus.com/wp-content/themes/messukeskus/assets/img/icons/ms-icon-144x144.png"
name="theme-color" content="#ffffff"

Load Info

page size100161
load time (s)0.163197
redirect count0
speed download613742
server IP188.117.27.178
* all occurrences of the string "http://" have been changed to "htt???/"