If you are not sure if the website you would like to visit is secure, you can verify it here. Enter the website address of the page and see parts of its content and the thumbnail images on this site. None (if any) dangerous scripts on the referenced page will be executed. Additionally, if the selected site contains subpages, you can verify it (review) in batches containing 5 pages.
favicon.ico: thelightshow09.blogspot.com - THE LIGHT SHOW.

site address: thelightshow09.blogspot.com

site title: THE LIGHT SHOW

Our opinion (on Friday 05 June 2026 21:33:54 UTC):

GREEN status (no comments) - no comments
page from cache: 1 day ago
Meta tags:

Headings (most frequently used words):

tls09, light, 2009, the, show, may, tls, lau, monday, 18, wednesday, about, links, featured, on, blog, archive, followers, love, and, welcome, lightness, of, being, celebrated, by, seven, skins, bernard, chauly, carolyn, fabian, tan, farah, azizan, jazmi, izwan, jamal, lisa, foo, loh, kok, man, mah, su, sim, richard,

Text of the page (most frequently used words):
the (219), and (194), light (79), with (59), for (52), tls09 (43), that (42), are (31), from (30), 2009 (24), dance (24), show (23), plastic (21), this (21), lau (18), art (18), his (18), design (17), foo (17), has (17), our (17), she (17), out (16), into (16), lighting (16), when (15), bottles (15), was (14), posted (13), made (13), have (13), were (13), designer (13), material (13), what (13), arts (13), lisa (12), carolyn (12), lights (12), more (12), her (12), not (12), can (11), objects (11), there (11), also (11), theatre (11), found (11), comments (11), but (11), who (11), been (11), man (10), some (10), film (10), all (9), richard (9), like (9), malaysia (9), new (9), sim (8), kok (8), exhibition (8), people (8), working (8), they (8), world (8), installation (8), interactive (8), such (8), now (8), would (8), mah (7), farah (7), azizan (7), tan (7), bernard (7), recycled (7), which (7), one (7), way (7), environment (7), director (7), just (7), waste (7), water (7), these (7), work (7), think (7), energy (7), music (7), works (7), between (7), will (7), may (6), featured (6), about (6), how (6), sculpture (6), discards (6), bags (6), creative (6), most (6), yet (6), landscape (6), architect (6), series (6), spaces (6), performance (6), since (6), each (6), oil (6), used (6), jazmi (5), fabian (5), chauly (5), seven (5), love (5), life (5), gallery (5), finding (5), lfss (5), different (5), fused (5), together (5), best (5), materials (5), currently (5), artists (5), only (5), much (5), set (5), recycling (5), less (5), project (5), sculptures (5), using (5), use (5), where (5), college (5), body (5), idea (5), sound (5), artist (5), their (5), its (5), five (5), well (5), aida (5), redza (5), loh (4), being (4), annexe (4), making (4), kuala (4), lumpur (4), process (4), end (4), however (4), bag (4), always (4), few (4), another (4), aswara (4), form (4), interest (4), maker (4), came (4), designers (4), other (4), mainly (4), artistic (4), passion (4), find (4), forms (4), soft (4), stage (4), aesthetic (4), create (4), thought (4), last (4), time (4), part (4), pet (4), low (4), lamps (4), international (4), surface (4), movement (4), visual (4), straws (4), technology (4), kunang (4), uses (4), multimedia (4), soda (4), make (4), glass (4), computer (4), than (4), living (4), childhood (4), centre (4), future (4), things (4), krishen (4), bulb (4), degree (4), sukarji (4), anne (4), james (4), created (4), ways (4), izwan (3), jamal (3), skins (3), klue (3), play (3), tls (3), disciplines (3), humour (3), inspire (3), producers (3), called (3), clear (3), free (3), join (3), nothing (3), house (3), early (3), age (3), say (3), mundane (3), mother (3), production (3), department (3), later (3), upon (3), own (3), looks (3), mineral (3), scale (3), eco (3), while (3), still (3), crafting (3), tools (3), over (3), natural (3), craft (3), after (3), experience (3), creativity (3), creates (3), exploring (3), boh (3), cameronian (3), awards (3), 2006 (3), 2007 (3), same (3), year (3), days (3), drinking (3), leds (3), sea (3), creatures (3), dark (3), deep (3), see (3), many (3), public (3), discarded (3), fireflies (3), based (3), human (3), university (3), installations (3), industrial (3), granted (3), national (3), architecture (3), inspired (3), architects (3), ago (3), should (3), guli (3), malaysian (3), remember (3), perhaps (3), china (3), event (3), renewed (3), food (3), convenience (3), mount (3), tins (3), planet (3), value (3), support (3), jit (3), astro (3), again (3), muzium (3), lampu (3), change (3), innovative (3), hardesh (3), singh (3), sriman (3), contemporary (3), pieces (3), choreographed (3), performed (3), shafirul (3), first (3), might (3), any (3), need (3), even (3), became (3), popular (3), celebrated (2), welcome (2), lightness (2), witness (2), rogueart (2), started (2), minded (2), cajole (2), home (2), comment (2), headlights (2), surrounded (2), challenge (2), resist (2), once (2), interesting (2), junk (2), potential (2), carried (2), away (2), your (2), encouraged (2), look (2), real (2), worked (2), revived (2), whilst (2), abbreviation (2), both (2), glance (2), appropriately (2), spells (2), intention (2), bottle (2), consumer (2), today (2), commercial (2), functional (2), maintaining (2), inherent (2), quality (2), ethereal (2), whether (2), treasure (2), sources (2), inspiration (2), lives (2), luminous (2), exist (2), recently (2), friend (2), features (2), reduce (2), hard (2), nature (2), expression (2), patterns (2), garden (2), special (2), humble (2), action (2), 2003 (2), founded (2), pentas (2), cultural (2), won (2), category (2), award (2), institute (2), full (2), singapore (2), bringing (2), turning (2), everyday (2), delight (2), response (2), transformation (2), spirit (2), saving (2), amazing (2), blue (2), fascination (2), city (2), expected (2), beyond (2), europe (2), 2008 (2), architectural (2), space (2), assemblage (2), nurturing (2), culture (2), softscape (2), medium (2), projection (2), paper (2), sounds (2), projected (2), random (2), during (2), night (2), power (2), producing (2), received (2), hons (2), majoring (2), member (2), performing (2), mobile (2), social (2), drumlight (2), floor (2), mounted (2), drums (2), inter (2), factory (2), heart (2), crates (2), empty (2), held (2), pop (2), brands (2), cola (2), high (2), blurring (2), 2001 (2), london (2), yellow (2), pages (2), had (2), joined (2), seksan (2), gdp (2), birth (2), long (2), movies (2), terrified (2), electrolyte (2), skin (2), feel (2), nostalgic (2), game (2), marbles (2), myself (2), wants (2), hope (2), cheeky (2), god (2), creations (2), coasters (2), believes (2), kitchen (2), assortment (2), guard (2), trying (2), forget (2), washed (2), lit (2), reflective (2), daily (2), nourishment (2), source (2), quickly (2), wish (2), them (2), throw (2), old (2), fund (2), makes (2), small (2), collection (2), down (2), recycle (2), vegetable (2), could (2), forward (2), initiatives (2), major (2), two (2), yes (2), significant (2), 100w (2), bulbs (2), earth (2), options (2), combat (2), climate (2), possible (2), around (2), usa (2), include (2), memorable (2), collaborations (2), fluorescent (2), june (2), thanks (2), germany (2), films (2), wearing (2), soul (2), others (2), bachelor (2), indonesia (2), program (2), dancer (2), choreographer (2), angin (2), suhaili (2), dancers (2), teaching (2), various (2), micheline (2), ahmad (2), kamil (2), azmi (2), suhaimi (2), loves (2), hailizan (2), mahmoon (2), eyes (2), day (2), without (2), discovering (2), took (2), chi (2), wei (2), going (2), through (2), green (2), efficient (2), chance (2), interaction (2), ann (2), lee (2), brought (2), rise (2), white (2), turns (2), malaysians (2), take (2), then (2), here (2), limiting (2), shows (2), quiet (2), presents (2), next (2), head (2), galeri (2), tenaga (2), admission (2), 10am (2), thursday (2), along (2), good (2), object (2), participants (2), driven (2), skip (2), rights, reserved, image, copyright, followers, blog, archive, luct, limkokwing, students, creation, second, edge, emmagem, shine, links, view, complete, profile, information, please, email, tlsers09, gmail, com, subscribe, posts, atom, assorted, shopping, ppe, pep, etc, fusing, layers, melted, hot, iron, result, tough, sheet, diffuse, coloured, piles, possibilities, scrap, endless, exhilaration, great, thing, reinvention, frustrating, figure, shape, reluctant, operate, never, accept, philosophy, quite, roadside, seeing, sets, juices, flowing, drawbacks, namely, chosen, cleaned, don, smell, rot, you, get, impulse, collect, becomes, garbage, dump, scavengers, looking, perspective, lectures, born, 1961, grew, decided, escape, pursue, course, humanities, england, discover, returning, builder, prop, across, raw, brut, abroad, resonated, undeniably, ubiquitous, examples, exercises, wares, manufacturers, opposite, bit, greener, cultivating, conscientious, attitude, thus, aimed, purposing, throughout, applying, basic, manual, skills, domestic, stationery, aspire, generate, worth, charm, field, years, nurtured, designing, leisure, chest, bursting, enrich, spills, radiate, abstract, representations, blueprints, live, flora, teamed, fashioned, branded, themselves, convey, message, perceives, fluid, revitalizing, extensions, structures, modeling, exterior, sculptural, elements, splendid, simply, resolute, integrating, aesthetics, functionality, evoke, calming, restorative, owns, oasis, assumes, responsibilities, relies, requires, refinement, accuracy, discretion, effects, longer, servant, meaning, thoughts, transition, winner, chinese, script, untitled, 2005, went, york, months, asian, council, fellowship, phoenix, rises, 5th, lost, ecliptic, 6th, ceacar, chong, ismail, established, actor, graduated, 1993, lecturing, drama, visuals, era, development, instructor, hands, percussions, drummers, aku, 1997, traveled, japan, korea, india, sharing, continents, mysterious, problem, thousands, transformed, individual, employing, embodied, emphasized, reduction, consume, mighty, rule, depths, mystical, realm, given, miss, landlubbers, rarely, bioluminescence, abyss, seascape, indulgence, experimentation, seeking, een, publications, australia, hong, kong, collaborated, exhibited, depicting, formed, effort, spread, awareness, persistent, innovator, emma, designed, completed, founder, fota, approach, concerned, experimenting, marries, objective, indoor, playground, imaginative, innovation, mapping, office, detected, sensors, camera, triggers, rhythmic, onto, colors, appear, emerge, user, comes, proximity, whole, share, beauty, represented, mapped, curtain, basically, unwanted, element, personal, digital, media, generative, experimental, musicians, cooperative, emacm, alumnus, asia, foundation, asef, favorite, gadgets, researching, site, specific, interventions, dealing, implications, emergent, technologies, group, standing, suspended, assembled, retain, mass, produced, module, replicated, comprises, utilitarian, furniture, connecting, functions, opportunity, chanced, derelict, filled, ceiling, forsaken, trove, ranging, obscure, peacock, sinalco, stacked, precariously, tower, blocks, trapped, zinc, roofed, cavern, guarded, solitary, pakcik, access, via, skillful, negotiations, worthy, politician, thank, him, cleared, likely, pave, consumerist, monument, seemingly, ambiguous, cityscape, 2000, pursued, diploma, riba, association, urban, ecologies, post, landscapes, boundaries, recent, chair, recordings, conversations, sinister, advertisers, graduating, 2004, freelanced, reluctantly, returned, looked, back, obtained, nottingham, artwork, signifier, creepy, evolution, intrigued, mankind, observing, lately, seems, assimilating, profusely, reliance, computers, heavier, ever, emails, internet, networks, games, softwares, laugh, notion, terminator, witnessing, slow, remind, emergence, breathing, entity, whirl, represents, veins, behind, beware, represent, fusion, abandoned, wooden, magic, experiment, involving, almost, extinct, child, stare, hypnotized, swirls, colours, floating, relative, virgin, maintain, naivety, digress, fantasies, fresh, concepts, corner, title, petronas, showcasing, emerging, participated, feast, beijing, parallel, entitiled, retrospective, kyoorius, designyatra, latest, roller, vintage, drink, golden, animals, wheels, star, newspaper, magazine, fashionable, definitions, pushed, existing, limitations, resultant, offerings, intends, nurture, lampshades, whisky, beside, deserted, apt, bases, implying, futile, inebriation, metaphorically, regarding, clean, perforated, linked, stitched, potentials, explored, glowing, shadow, casting, colouring, reworking, repeated, components, relives, routine, consumption, comprise, household, ready, solicit, contemplation, yoghurt, milk, cartons, jars, packets, frugality, resourcefulness, dexterity, simple, children, large, doses, help, survive, uncertain, half, frugal, botol, cruised, neighborhoods, buy, bread, reused, toys, enjoyably, hand, magazines, reformed, bead, curtains, largely, undervalued, forgotten, why, discard, litter, because, those, hold, assumed, taken, memories, watching, parents, clothes, canoes, pots, fishing, nets, traps, chicken, coops, jewelry, gifts, gardens, previously, dabbled, costume, receiving, honour, partner, affiliate, company, sd2, sdn, bhd, pedestrian, trigger, precious, laughs, whenever, cook, told, pour, cooking, drain, illegal, agrofuel, cars, biofuels, forests, plant, palm, agro, fuel, steps, president, barack, obama, biggest, polluters, america, partnership, battle, against, global, warming, phasing, heard, traditional, 100, watt, incandescent, phased, favour, alternatives, save, hear, difference, too, late, fairy, dangle, tree, dataran, merdeka, before, display, banned, excessive, wastage, electricity, commemorate, historic, agreement, litre, converted, biofuel, surviving, highlights, selamat, datang, studied, universiti, sains, goldsmiths, credits, gol, gincu, goodbye, boys, finishing, third, feature, pisau, cukur, cinemas, creator, especially, janet, pillai, rama, sita, generasi, baru, family, staged, berlin, proud, zha, teater, muda, 1999, puppet, toured, badminton, courts, dbkl, flats, milo, likes, wattage, thinks, halogen, spots, recommended, favourite, dedo, diva, joseph, gonzales, marion, cruz, producer, turned, technopreneur, holds, telecommunications, engineering, soundworks, productions, carving, name, himself, locally, internationally, albums, local, rock, remix, release, festivals, scored, numerous, commercials, winning, mask, burn, interact, master, fine, smith, jakarta, center, malaya, appointed, coordinator, known, javanese, classical, globally, including, circle, bliss, darkness, awakening, manuhara, nourishments, helps, noticed, thirst, aged, actively, kids, teaches, aurora, school, earned, victorian, melbourne, perform, sadly, very, opportunities, reacting, independent, enjoys, studying, choreography, sing, splendoured, open, comforting, beacon, harsh, reality, reflecting, cannot, imagine, void, spirited, true, certain, somewhere, odissi, 1992, finally, plunge, learning, ramli, ibrahim, decade, sutra, seen, donna, miranda, extended, periods, waiting, central, market, zulkifli, mohamad, selipar, jepun, cabaret, performer, stor, dbp, interacting, lancelets, headgear, selendang, lighttorchchandeliertaperbeacon, sparkleglistenfireflyflickerreflectionglowwormdaylight, sunbeammoonshinehalonimbusauranebulalightningcandle, raysflareflameglimmershimmertwinkle, radiantshinelustersheenglowincandescenceafter, glowluciditybrightsplendorglareblazeblindingbeamsolar, acting, happy, snatch, theft, victim, political, turmoil, march, necessary, cleansing, convinced, come, period, nation, illuminating, resonating, romance, embodiment, prominent, performers, unique, backgrounds, amidst, web, team, presented, choreographic, challenges, spreading, senses, candle, emanating, dependance, wild, flowers, hair, whose, example, tight, bound, tradition, deconstruction, interdisciplinary, principles, happening, intervention, within, videography, nazim, esa, managed, costumes, uhaili, rehearsal, mostly, writer, playwright, divides, history, science, medicine, excerpts, catalogue, appropriate, times, near, far, transparency, politicians, innocents, angels, murkier, intents, streetlamps, cctv, cameras, seem, cast, rising, crime, rate, lava, exactly, passé, plasma, globes, launch, anything, losing, bear, ruled, land, solo, monotonous, morning, bungalow, apartment, block, room, boardroom, security, pondok, stesen, keretapi, sure, hardy, tubing, unbeatably, cheap, lasting, relief, least, warm, cool, tone, hours, inside, outed, events, developers, ikea, afford, enjoy, variety, package, paint, colour, feeling, move, does, none, gone, call, bangladeshi, polemic, wears, environmentalism, often, tedious, smug, ideology, conviction, face, scientific, consensus, humans, impact, complacency, pussycat, purr, caress, carbon, footprint, trading, intellectual, peril, cycle, rescue, deeply, conservative, ethos, restraining, order, hippy, laidback, meanwhile, beginning, snuff, irrespective, mortal, efforts, integrity, instances, ample, evidence, adept, range, environmentally, conscious, footed, leaden, bastardized, beautiful, fashioning, emitting, diodes, combinations, artificial, preoccupations, elegant, startling, affects, interiors, wit, clarity, plain, persuasive, bright, minds, divisions, discipline, viewed, audiences, appearing, soon, greatest, 1920s, fascinated, prospects, famously, dusseldorf, three, month, images, attended, millions, arena, filmmaker, providing, evocative, insight, heritage, private, taste, predilection, bravura, extravaganzas, surprises, sometime, fuse, confident, flair, fear, line, must, deal, debris, unbridled, consumerism, charming, provocative, imagination, sofa, harnessed, strong, conceptual, practical, twist, sees, adroitly, ingenuity, sip, folks, derived, joy, behold, suggest, migrants, migraines, detritus, present, duo, continues, intriguing, shapes, deeper, earlier, visits, marine, diversity, heads, lampshade, apron, headpiece, raft, surely, signs, progress, tiny, solution, scheme, sum, praise, regret, epic, hopefully, annual, extend, sites, wherever, though, rare, indeed, examining, know, congratulations, balai, seni, lukis, negara, exhibitors, mon, fri, 5pm, sat, 2pm, saturday, wisma, tnb, petaling, jaya, 11am, 7pm, april, sunday, wednesday, earn, brownie, points, promoting, mantra, reuse, manages, achieved, goal, contributing, creatively, towards, journey, moving, alone, scarce, enough, deepest, gratitude, generous, sponsors, supporters, enabling, realise, rewarding, particularly, results, absolute, icing, cake, easy, coupled, label, sits, comfortably, regardless, enable, expand, perceptions, already, difficult, number, traditionally, disparate, board, spatially, emotive, experiential, ephemeral, add, instinctively, preferred, tls09ers, mix, seeds, sown, www, surfing, ogling, corners, thinking, walk, talk, serendipity, word, carries, positive, connotations, everyone, behalf, monday, explores, upcycling, sidebar, main,


Text of the page (random words):
abian tan farah azizan jazmi izwan jamal lisa foo loh kok man mah su sim and richard lau the light show 2009 was made possible with support from the krishen jit astro fund with thanks to galeri tenaga gdp architects and balai seni lukis negara national art gallery of malaysia posted by tls09 at 10 00 pm no comments a welcome lightness of being by ann lee how appropriate that there should be a light show during these dark times when we would be so near yet so far to more transparency when some of our politicians would be innocents and angels but have been brought down hard by murkier intents when streetlamps and cctv cameras seem to cast nothing on the rising crime rate and while lava lamps are not exactly passé plasma globes are still used to launch anything new we might well be losing our way with this show we bear witness to the end of the fluorescent light that once ruled the land solo and monotonous from morning to night in bungalow and apartment block high rise and low rise living room and boardroom security guard pondok and stesen keretapi to be sure this hardy tubing is unbeatably cheap and lasting but what a relief that at least now there are warm white and cool white tone options our hours have been and are being inside outed not only by turns of events but also by designers developers and ikea now more malaysians can afford to enjoy a variety of light and not just an astro package to paint their lives with colour and feeling these are new ways to move the human spirit still how many malaysians does it take to change a light bulb none they ve gone to call the bangladeshi if there is any polemic this show wears then it is environmentalism so often this is a tedious and smug ideology such conviction in the face of no scientific consensus that humans do have a real impact on the future of the planet such complacency that nature is a pussycat that will purr to the caress of carbon footprint trading such intellectual convenience in the idea of a planet in peril and all we need do is re cycle and re use to rescue it how deeply conservative this ethos and what a restraining order even as it looks so hippy and laidback meanwhile there is god who made the world in seven days beginning with light and might just snuff it out irrespective of mortal efforts in this show however there is an integrity of idea that in most instances has ample evidence to support that is with adept use of a range of materials created found and or recycled here is an environmentally conscious aesthetic that is light footed not leaden not just bastardized also beautiful the old and new fashioning with light emitting diodes leds and plastic bottles combinations of natural and artificial light sources preoccupations with the elegant and startling and how light affects spaces and interiors this is wit clarity and craft that is plain to see and persuasive bright minds are also making light work of the limiting divisions of discipline between architect theatre maker and film maker when movies were first viewed they terrified audiences for appearing as if out of nothing but they soon became popular as the greatest light shows on earth in the 1920s various artists were fascinated by the prospects of the new art and famously in dusseldorf germany a three month long exhibition was held using projected images music and dance that was attended by millions such was fascination with the new form in the arena of this show filmmaker bernard chauly can be found providing a cheeky yet evocative insight into the heritage of private and public taste in lighting kok man theatre director and lighting designer with a predilection for innovative even bravura extravaganzas of experience turns up a series of quiet surprises landscape architect and sometime set designer carolyn lau presents lamps and other works that fuse a confident designer s flair with a mother s fear for the next in line who must deal with the debris of unbridled consumerism she makes innovative do with the discarded in charming yet provocative ways farah azizan s imagination which brought us the memorable yellow pages sofa is again harnessed in strong conceptual work with a practical twist jazmi who sees such potential in mobile technology creates an installation with humble ol straws adroitly turning what we take for granted on its head such human ingenuity sip on it folks architect fabian tan s gu light forms derived from the marbles of the popular childhood game are a joy to behold richard lau s head lights suggest that we might all be migrants with migraines from the detritus of present day living yet we will find ways to go on the artistic duo of lisa foo and mah su sim continues to create intriguing new shapes going deeper than their earlier visits into marine life that created a popular series of deep sea creatures the show s diversity of movement sound and music together with sculpture fused plastic bag heads oil drums and soda bottles multimedia installation lampshade apron water bottle headpiece and a raft of other pieces are surely all signs of progress they are each a tiny solution in the scheme of things but in sum like fireflies they are around to be found praise be if there is one regret it is that there are no epic pieces here perhaps we can look forward to even more in the next light show hopefully it will be an annual event and extend to sites wherever for now though experience the rare chance to delight indeed in re examining what we need what we use and what we know congratulations to the producers carolyn lau farah azizan and lisa foo ann lee is mostly a writer and playwright who divides her time between indonesia and malaysia she has a degree in film and another in the history of science medicine and technology excerpts from tls09 catalogue posted by tls09 at 9 45 pm no comments tls09 celebrated by seven skins seven skins in rehearsal a dance performance choreographed by aida redza performed by aida redza anne james foo chi wei hailizan mahmoon shafirul azmi suhaimi s uhaili micheline ahmad kamil and sukarji sriman music by hardesh singh costumes by carolyn lau and lisa foo stage managed by june tan videography by nazim esa aida redza is a dancer and choreographer whose works are a visual example of tight bound tradition deconstruction and new dance she is mainly inspired today by interdisciplinary collaborations based on the principles of chance happening as well as the intervention and interaction of the performance body within public spaces when i think of light i think of skin lighting up when i think of dance i think of wearing wild flowers in my hair when i think of green energy efficient light and dance i think of the ways of spreading the body and senses as a candle or reflective surface emanating the love and inter dependance between dance and light bringing together five prominent and significant performers from different and unique performance backgrounds to join me in discovering and exploring each our own special light amidst the web of light created by the tls09 team has presented us with seven choreographic challenges of illuminating and resonating the romance of dance with the embodiment of light anne james loves acting is happy to dance again is finding her life renewed in teaching theatre is a member of five arts centre is a snatch theft victim believes that the political turmoil malaysia has been going through since march 8 is a necessary process of national cleansing is convinced that we will come through this dark period renewed as a nation and a people light radiantshinelustersheenglowincandescenceafter glowluciditybrightsplendorglareblazeblindingbeamsolar raysflareflameglimmershimmertwinkle sparkleglistenfireflyflickerreflectionglowwormdaylight sunbeammoonshinehalonimbusauranebulalightningcandle lighttorchchandeliertaperbeacon anne james interacting with lisa foo s lancelets a headgear and selendang made from pet bottles and leds foo chi wei is always spirited it would be true to say that if there s some action foo is certain to be in there somewhere discovering odissi for the first time in 1992 foo finally took the plunge in learning the dance form from ramli ibrahim a decade later in 2001 at sutra dance theatre in 2007 he was seen in donna miranda s contemporary dance production extended periods of waiting at the annexe central market later the same year he also took part in dr zulkifli mohamad s play selipar jepun as a cabaret performer at the stor theatre dbp kl light is many splendoured things to me light is when i first open my eyes each day light is comforting beacon to the heart light is harsh reality light is the soul reflecting in one s eyes i cannot imagine a world without light that would be a void without forms hailizan mahmoon is mother of aida redza she loves to sing shafirul azmi suhaimi is an independent artist who enjoys working in contemporary spaces currently studying dance at aswara majoring in choreography shafirul sukarji reacting in loh kok man s blue stage lighting suhaili micheline ahmad kamil aged 24 has been actively teaching dance to kids since the age of 17 she now teaches at aswara and aurora school of dance she earned a bachelor of dance hons and various awards from the victorian college of the arts melbourne her passion is to perform more but sadly very few opportunities such as this event exist light helps me to be noticed the way i see it dancers thirst for light will always be suhaili and anne james exploring the light by carolyn lau s nourishments sukarji sriman received a master of fine arts degree in dance from the five college dance department smith college usa and a bachelor of arts degree in dance from the jakarta institute of the arts indonesia in early 2006 he joined the dance program culture center university of malaya and has now been appointed as coordinator of the dance program sriman is well known as a javanese classical dancer and as a contemporary choreographer more than 20 of his dance pieces have been choreographed and performed globally including the circle of bliss a time of darkness awakening manuhara and angin angin light is life light can burn my body and soul to dance to interact with others sukarji wearing a fused plastic bag mask by richard lau hardesh singh is a music producer sound designer turned technopreneur who holds a degree in telecommunications engineering he founded soundworks productions in 2003 carving a name for himself locally and internationally with albums for local pop rock and r b artists as well as a remix release in germany his music sound design for films have been featured at major international film festivals he has scored for numerous commercials and international award winning films with thanks to marion d cruz joseph gonzales and aswara june tan posted by tls09 at 9 40 pm no comments tls09 bernard chauly bernard chauly is a film director and tv series creator who started out with a passion for theatre most of his work as lighting designer was for five arts centre working especially with krishen jit and janet pillai two memorable creative collaborations were made with carolyn lau as co lighting designer for rama sita generasi baru and as lighting designer set designer for family staged in kl and berlin bernard s proud of lighting for a show called ne zha teater muda five arts centre 1999 an innovative puppet show that toured badminton courts of dbkl flats lights were made out of milo tins at home he likes low wattage bulbs only uses fluorescent if it s t5 and thinks halogen spots are over recommended his favourite film lights are called dedo and diva bernard studied at universiti sains malaysia and goldsmiths college his film credits include gol gincu goodbye boys and is currently finishing his third feature film pisau cukur in cinemas 2009 selamat datang ke muzium lampu 2009 highlights last surviving 100w bulb in the world last litre of used vegetable oil not converted to biofuel energy saving light bulb lit to commemorate historic agreement between usa china to combat climate change last fairy light to dangle from a tree around dataran merdeka before display of lights banned as excessive wastage of electricity muzium lampu is a collection of light objects from a possible future a while ago i heard that traditional 100 watt incandescent light bulbs are being phased out in favour of low energy alternatives will it save the earth everyday we hear of initiatives and options to combat climate change all have to do our part yes but will it make a difference some would say it s too late small initiatives vs major steps us president barack obama wants the world s two biggest polluters america and china to form a partnership in the battle against global warming yes they should perhaps this would be more significant than just phasing out the 100w bulb whenever i cook i m told not to pour used cooking oil down the drain what if it was illegal not to recycle used vegetable oil into agrofuel that could power cars are biofuels the way forward if so do we have to clear more of our forests to plant more oil palm a source material for agro fuel muzium lampu is just a small collection of pedestrian light objects to trigger some precious thought and a few laughs about what if s to do with light posted by tls09 at 9 30 pm no comments tls09 carolyn lau carolyn lau is a landscape architect with seksan design and partner of affiliate company sd2 sdn bhd she has previously dabbled in set costume and lighting design for theatre receiving support from the krishen jit astro fund makes her feel like she s working with krishen again what an honour childhood memories are of watching her parents making food tools sculpture clothes canoes pots bags fishing nets traps chicken coops jewelry gifts gardens nourishment 2009 why do people discard and litter so much because those things hold no value to them convenience is expected assumed taken for granted the craft of frugal living where the botol man cruised neighborhoods to buy used glass and tins where plastic bread bags were washed out and reused where toys were enjoyably hand made with much make do where old magazines were reformed into paper bead curtains is now largely undervalued if not forgotten i am nostalgic for that frugality for the resourcefulness dexterity and simple creativity that came with it i wish for my children large doses of it to help them survive their uncertain future as i wish for myself and half this planet so i am trying to find value in what i throw out my works for tls09 comprise of daily discards from my kitchen centre of nurturing and nourishment source of the most household waste discards that quickly mount up as ready material solicit contemplation yoghurt bottles food tins milk cartons glass jars 3 in 1 packets plastic bags washed clean perforated linked fused stitched lit up each material s potentials are explored whether reflective glowing shadow casting or colouring light reworking each material as repeated c...
Images from subpage: "thelightshow09.blogspot.com/2009/" Verify
Images from subpage: "thelightshow09.blogspot.com/2009/05/" Verify

Verified site has: 17 subpage(s). Do you want to verify them? Verify pages:

1-5 6-10 11-15 16-17


The site also has references to the 2 subdomain(s)

  lfss-create.blogspot.com  Verify   art2play.blogspot.com  Verify


Top 50 hastags from of all verified websites.

Supplementary Information (add-on for SEO geeks)*- See more on header.verify-www.com

Header

HTTP/1.1 200 OK
Content-Type text/html; charset=UTF-8
Expires Thu, 04 Jun 2026 06:14:26 GMT
Date Thu, 04 Jun 2026 06:14:26 GMT
Cache-Control private, max-age=0
Last-Modified Thu, 05 Sep 2024 19:27:42 GMT
ETag W/ 5078618ac156ca90b202d97320560802886d3df27af768f111bef489018a4db4
Content-Encoding gzip
X-Content-Type-Options nosniff
X-XSS-Protection 1; mode=block
Content-Length 31385
Server GSE
Connection close

Meta Tags

title="THE LIGHT SHOW"
content="text/html; charset=UTF-8" http-equiv="Content-Type"
content="blogger" name="generator"
content="htt???/thelightshow09.blogspot.com/" property="og:url"
content="THE LIGHT SHOW" property="og:title"
content="LIGHT SCULPTURE EXHIBITION EXPLORES ON THE IDEA OF UPCYCLING" property="og:description"
name="google-adsense-platform-account" content="ca-host-pub-1556223355139109"
name="google-adsense-platform-domain" content="blogspot.com"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgessK0kCLE5ovh-AXx-kY7M5SmfzGBvGq_rn-Ly2tAhIE8htku7GumFHnlInL40cy7SjjrTx_DTOU__fr0ZHk-azWPmcMATzdR0uRZ4xA-7J7necxsGa5fjMyIoSieW0CHNJ4ju6Z5Mnbk/s400/TLS09.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="381501306538222933" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-love-and-light.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiDDBmIXIbEyUByYcp5bFrVBPp0TQ3h0i8ZqnrOy5TPP3nq8ZtjVC7yNLEhIP7vE-QVva7MX315DABKh6fBrSYktcG7y8nDo6Pqb3elMjVhmMmmS06zbLYoFXoNoP4I5wLb7zP704QCaeEn/s400/tls+front.jpeg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="5531813476854214536" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/light-show-2009.html" itemprop="url"
content="9137002448263389497" itemprop="blogId"
content="7531212065181862447" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-welcome-lightness-of-being.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiayYV7FCFrR2hnYdDH1HcUpLN0ttdsNuF5iUvR5v7SDOAUQkOdTUAKUvWo8Sa1P22FNogDI1KAsDMAPJFqYaGbA-RvdsT7JucTsVPS9q3tNCa0TFxwEtC6jXBXFw-E207lu624_lWQz0vm/s400/seven+skins.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="462058955054556110" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-performance-by-seven-skins.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhpj-Iam4JS8Moo6l7g9mEhm0-u3wH3O1KmcwqNqTaHgA2F7w1pvGU3EFeMRvGOTJF7TCwuD6yY6c-l-tX2KEnTniSJ-haugOyFdFTnyWJ4l2dYsaUwa1g6lM6naCp0juYfxxQewDLXPbOJ/s400/bernard-all1.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="5394479410677187811" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-bernard-chauly.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjkEA3LVGbvwORobYnvObiNrbsViezT_7Spz-FrsUMHD0E032KK1yixGtXPBqTdlpO5Yt66UIPqCqyu-IjH3mr9cMtOWXzQwakwnb0RsOLCMa4Px24qYkmbOes7wukMFxx7731QDfSyAdj8/s400/carolyn2.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="1294997394475742827" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-carolyn-lau.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjYC4g48fdUknQ1jJAE_ts7f9X50C7zSsuflJUVH01IPZz4Qj-_067V4QhETgCtxEgM9VJdjsqcw51RsqEGgiuChnphhTDixaw-Q0IfXIlr5JSi8BUgVwz7QBCGlQAvVYfi7ZaFdi_64t-r/s400/3186_91824743486_664118486_2518435_2588898_n.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="7781333517825240144" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-fabian-tan.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj-nh4aGzdwXtcEpI5oiMbN-Xjkm6czFv4aDo4K-pFQFz3CwZsnWYx7tHmJjugwyrBfPkzbzidTveRb4LH-uUAvMU8TiVSadVK65qagATbii4yoEj4G1fOwyzQm46iNyady8dfC9EWomDbZ/s400/n705857904_2340063_8093375.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="4141126611721298071" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-farah-azizan.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh3bjCx-p1ktWvUylLORnF0P3UAT5ITMxxdt0e7eblg8qpME_4SeE1Yd_RZDxIBgqVRBfjVrIRp_HV8xjvXy35sU5hkX1sVOfjObcHxvykKEOTsHd1Q3lrqfN_4F4mbAywKDKKfFFPIR_N6/s400/jazmi1.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="339072372985992865" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-jazmi-izwan-jamal.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgqpo8WBA4HCoH40u4H3lvhjnVgfInqGJZvCya_J1Hws2KiC6_EA6DtgzHN3PJHrAtV8k6zURfwU-UXUgNnIg57apLIOxL5_1hpYIhxqGrr-hNeI_8yTZrKdrKOgVtnMwxR7SfobQ0mfAXs/s400/3186_91740273486_664118486_2517493_4819624_n.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="8534574268553076256" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-lisa-foo.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEikRONwjzs-OOChRWcmFrT0RUnWuXF3anne_bB4ytkMXh4wt9hP7RaNFGpeU8BZO3BzT05_G1srAceEdPJg_DGtZ5vGNzLpXkMqqay-JdfGEr1ld70aPwjTM0UWNWIVXLyWf9TXOjrEKpZL/s400/kokman.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="395117919884851008" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-loh-kok-man.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhQYokyoZFQ-pKPz7d-oJFWGBPYsF-3M4ucVLLE_r2vLf1YdzMcXpmoIRiAC3HFOtNmQ1W_Mv8sQEA510ht9q4vubAGLfc9x6xzAw6aEUJkNSlWglgHDhDWeQ94564kqyy3KFLEQ0NIi4wn/s400/3186_91745528486_664118486_2517585_2534317_n.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="2000723537811617352" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-mah-su-sim.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi72tIXBacyiiJqbAAxY1Tb2PPvJhxivXo7KfeYTlOfdlRcQ88dJrDgZVcETjP2oRNL3Jf8q5jY-a6foCD20MEq9nY5ufbRTUBaZD6gNz-1GWQpIMZpAQ08gDtDkeKYeZNX-_evhNjAlvrR/s400/richard.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="6135210974208563572" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-richard-lau.html" itemprop="url"

Load Info

page size134354
load time (s)0.295203
redirect count0
speed download106389
server IP 172.217.22.193
* all occurrences of the string "http://" have been changed to "htt???/"