If you are not sure if the website you would like to visit is secure, you can verify it here. Enter the website address of the page and see parts of its content and the thumbnail images on this site. None (if any) dangerous scripts on the referenced page will be executed. Additionally, if the selected site contains subpages, you can verify it (review) in batches containing 5 pages.
favicon.ico: perthperth.com - Perth Western Australia, 2025,.

site address: perthperth.com redirected to: perthperth.com

site title: Perth Western Australia, 2025, Tourist, Business Information

Our opinion (on Monday 25 May 2026 3:31:53 UTC):

GREEN status (no comments) - no comments
After content analysis of this website we propose the following hashtags:



Meta tags:
description=2025 list of Perth s best tourist attractions and business information about Perth Western Australia. Contact Perth WA businesses websites / phone numbers.;

Headings (most frequently used words):

perth, business, in, services, of, australia, 2025, the, photos, marketing, to, hotels, furniture, online, by, tourist, information, western, new, website, after, years, as, most, issolated, city, world, welcomes, back, tourists, job, seekers, and, expats, map, things, do, day, trips, watch, youtube, videos, about, house, latest, news, property, mining, companies, education, restaurants, maps, social, media, links, trades, engineering, healthcare, near, popular, northern, suburb, bali, hours, flight, from, beaches, travel, car, transport, swan, valley, hillarys, boat, harbour, office, fitouts, digital, wall, calendar, shopping, store, it, support, computers, medical, emergency, fall, alarm, sales, worn, elderly, good, gift, idea, family, owned, based,

Text of the page (most frequently used words):
perth (272), the (68), and (40), for (35), #services (24), business (21), best (20), map (18), 2025 (17), marketing (16), #australia (13), new (12), beach (12), from (12), sale (10), online (10), western (10), office (10), australian (9), popular (9), with (9), house (9), near (8), beaches (8), holiday (8), google (8), expert (8), home (8), businesses (7), loans (7), advertising (7), world (7), good (7), sales (7), park (7), mining (7), restaurants (7), swan (7), are (7), northern (6), tourist (6), north (6), south (6), hotels (6), agency (6), including (6), local (6), your (6), coast (6), river (6), list (5), photos (5), service (5), boat (5), thailand (5), hours (5), city (5), you (5), surgery (5), shoulder (5), knee (5), tradie (5), cheap (5), computer (5), web (5), property (5), affordable (5), fremantle (5), day (5), airport (4), hire (4), destination (4), see (4), suburbs (4), furniture (4), training (4), phone (4), harbour (4), video (4), indian (4), many (4), market (4), seo (4), most (4), more (4), which (4), renovation (4), cbd (4), tour (4), kings (4), train (4), valley (4), things (4), price (4), watch (3), transport (3), surfing (3), big (3), flight (3), get (3), hip (3), pain (3), book (3), orthopaedic (3), replacement (3), building (3), also (3), sea (3), rate (3), digital (3), free (3), sunset (3), scarborough (3), hotel (3), production (3), cuisine (3), event (3), ethnic (3), high (3), food (3), public (3), link (3), one (3), about (3), average (3), insurance (3), real (3), estate (3), coach (3), premium (3), consultant (3), tourism (3), trade (3), bus (3), visit (3), guided (3), down (3), migrants (3), top (2), cars (2), wide (2), mobile (2), car (2), used (2), escort (2), escorts (2), com (2), links (2), all (2), yacht (2), clubs (2), cycling (2), fishing (2), photo (2), thai (2), capital (2), europe (2), winter (2), during (2), while (2), wet (2), season (2), satelite (2), drive (2), mandurah (2), singapore (2), bali (2), suburb (2), treatment (2), contact (2), need (2), support (2), appointment (2), surgeon (2), who (2), injury (2), chronic (2), have (2), fall (2), companies (2), search (2), find (2), website (2), tradies (2), location (2), buy (2), into (2), container (2), gardening (2), low (2), interest (2), quality (2), aerial (2), installation (2), hillays (2), opportunity (2), maps (2), spring (2), videos (2), photographer (2), restaurant (2), italian (2), chinese (2), come (2), multicultural (2), population (2), has (2), different (2), types (2), cooked (2), makes (2), prices (2), shopping (2), schools (2), private (2), than (2), off (2), per (2), text (2), design (2), company (2), first (2), consultants (2), problems (2), houses (2), other (2), rates (2), yes (2), costs (2), apartments (2), land (2), both (2), news (2), financial (2), investment (2), brokers (2), life (2), websites (2), research (2), broker (2), registration (2), international (2), fitout (2), store (2), after (2), live (2), some (2), tame (2), rottnest (2), island (2), ocean (2), museum (2), 2022 (2), catch (2), lunch (2), beautiful (2), zoo (2), there (2), such (2), parks (2), hillarys (2), wine (2), kangaroos (2), pinnaroo (2), natural (2), frequent (2), summer (2), accommodation (2), skilled (2), invest (2), huge (2), workers (2), what (2), weekly (2), rental (2), median (2), along (2), side (2), over (2), freeway (2), attractions (2), west (2), state (2), information (2), print, version, pdf, suv, mechanic, fuel, taxis, limo, male, female, brisbane, mcg, corporate, box, holidays, mapgoogle, airlines, travel, poll, rules, football, 300, pen, marina, engish, speaking, guide, krabi, perthites, phuket, air, hub, airasia, time, bangkok, stopover, dubai, northwest, broome, rest, green, samui, dunsborough, town, supplies, vitamins, health, products, chemists, clinic, locations, doctors, hospitals, teeth, whitening, dental, implants, dentists, retirement, villages, lymphatic, drainage, massage, disability, aged, care, ndis, spesialising, amazing, printed, drill, bit, guides, personalised, perfect, fit, spcialises, treatement, stop, consultation, leading, arthritis, emergency, worn, elderly, gift, idea, family, owned, based, alarm, medical, healthcare, bricklayer, small, finding, work, handyman, stores, osborne, alternativly, sold, tiny, portable, conversions, containers, storage, gardener, equipment, computers, optiamal, picture, chris, number, 0477, 696, 401, anetnna, trades, engineering, pinterest, social, media, getting, outer, street, wildflower, wildflowers, photograph, 360, vietnamese, cafes, traditional, spanish, that, will, function, party, paella, catering, mostly, asia, given, rise, fusion, ideas, gourmet, delicious, dining, experiences, chemist, calls, detection, alarms, current, sell, yourself, wall, calendar, dates, music, lessons, universities, software, education, here, juice, sites, westernaustralia, ppc, 110, year, plus, setup, nofollow, 365pa, dofollow, mine, minerals, processing, gas, water, electricity, numbers, connections, disconnections, utilities, architects, custom, designed, buildings, compared, past, still, worthwhile, apply, loan, say, often, save, commissions, selling, youself, diy, apartment, valuations, second, story, extension, specialist, builders, settlement, agent, partitions, space, directory, agents, vacate, clean, paint, maintenance, management, size, blocks, vacant, less, hour, under, 200, 000, remax, statistics, weather, forecast, latest, accounting, tax, accountant, secret, atm, camera, scam, planner, finance, personal, pay, click, monthly, cost, engine, domains, lease, exact, match, internet, this, guest, speakers, relations, winning, experienced, making, agm, modelling, fashionable, women, clothing, models, export, landscape, prints, printer, agencies, shows, network, influencers, bookkeeping, planning, advice, mark, comercialisation, innovation, domain, name, multilingual, use, pwd, wizzards, week, build, designers, designer, recommended, affordably, priced, reviews, absolute, comforts, fitouts, dan, recommened, osbourne, swim, bathers, historic, prison, before, surf, cam, checkout, sailing, boads, windsurfing, boogieboading, boating, sheltered, meet, quokkas, eat, styles, dine, stadium, sporting, centre, arts, fine, openned, art, gallery, cottesloe, part, trip, fabulous, coastline, formaly, known, tours, youtube, enjoy, picnic, grounds, gardens, walk, elizabeth, quay, ferry, station, transperth, vineyards, cruise, recreation, flat, terrain, arround, lakes, spend, exporing, fun, include, visiting, trips, cemetary, hundreds, close, walking, through, bushland, attend, outdoor, events, autumn, promotion, star, scarboro, info, temporary, residency, visas, available, establish, manage, ready, help, shortage, jobs, easy, howerver, living, important, consideration, when, moving, not, 700, settlers, countries, aboriginals, developed, includes, europeans, africans, asians, large, communities, northbridge, variety, cuisines, greater, extends, 100, kilometres, cities, joondalup, they, connected, regular, modern, runs, lane, feeder, connect, stations, middle, mitchell, stone, fruits, grown, hills, should, plentiful, below, our, years, issolated, welcomes, back, tourists, job, seekers, expats, escaped, covid, boom, administrative, government, headquarters, vast, energy, powerhouse, economy, marmion, marine, wonderland, views, east, central, district, sky, scrapers, overlook, overlooks, interstate, gateway, pristine, environment, man, made, hill,


Text of the page (random words):
perth western australia 2025 tourist business information perth australia 2025 tourist business information perth western australia perth western australia is the west coast state capital on the east coast of the indian ocean perth central business district cbd new sky scrapers overlook the swan river while kings park overlooks both perth is the interstate and international gateway to tourist attractions of western australia s pristine environment including some of the world s best beaches natural and man made parks including the huge hill top kings park with views over the swan river and perth cbd also the marmion marine park on the sunset coast is a wonderland of sea life new perth australia 2025 website perth western australia escaped most of the covid 19 problems in 2022 it s the west coast boom city of the administrative government and business headquarters of the vast australian state of western australia which is the energy and mining powerhouse of the australian economy after years as the most issolated city in the world perth welcomes back tourists job seekers and expats to perth settlers from many different countries have come to live along side australian aboriginals and developed perth s multicultural population which includes europeans africans asians such as the large indian and chinese communities visit fremantle or northbridge for a variety of ethnic cuisines from all over the world greater perth extends 100 kilometres from the satelite cities of joondalup in the north to mandurah in the south they are connected by a regular frequent modern train service which runs along side the 8 lane freeway feeder bus services from perth s suburbs connect with train stations in the middle of the north south mitchell freeway perth s wet winter is good for stone fruits grown in perth hills and should be plentiful in the summer of 2025 below is our 2025 list of perth s best tourist attractions things to do and perth businesses temporary residency visas are available for skilled migrants and for migrants to establish and manage a business or to invest perth business brokers are ready to help investment migrants to perth invest in a perth businesses for sale in 2025 there is a huge shortage of workers jobs in perth are easy to get for skilled workers howerver high living costs are an important consideration when moving to perth food and accommodation in perth are not cheap what is the average weekly perth rental price in 2025 the average weekly rental price in perth in 2025 is 700 what is the median house price in perth the median price of perth houses for sale in 2025 is 1m photos of perth more photos of perth perth map map of wa map of australia perth hotels map scarborough beach scarboro info more perth beaches 5 star hotels perth hotels near perth australian tourism promotion hotel perth accommodation holiday apartments perth beach hotels perth things to do in perth attend an event in perth outdoor events in perth are frequent in spring summer and autumn kangaroos in perth at pinnaroo cemetary see hundreds of tame kangaroos close up on a cheap guided walking tour in perth through natural bushland and down into the pinnaroo valley day trips perth things to do in or near the perth cbd include visiting the new perth museum swan valley perth go on a fun guided swan valley wine tour including lunch and premium wine hillarys boat harbour spend the day exporing things to do at hillarys boat harbour recreation such as cycling perth s flat terrain arround it s many beautiful parks and lakes visit kings park or go on a swan river cruise from perth down river to fremantle or up the swan river to the vineyards of the swan valley catch the transperth bus or train to the perth train station from there walk down to elizabeth quay and catch a ferry to south perth for a day at perth zoo enjoy a picnic lunch in the grounds of the beautiful zoo gardens watch youtube videos about perth book a private guided day tours of scarborough beach cottesloe beach fremantle and hillays boat harbour as part of a day trip of the fabulous coastline of perth s sunset coast formaly known as perth s northern beaches visit a perth art gallery and the new perth museum openned in 2022 fine arts perth bus tour of perth s city centre including kings park watch a sporting event at perth stadium dine at perth restaurants and eat premium western australian food cooked in many types of ethnic cuisine styles at perth s indian ocean beaches rottnest island near perth has some of the best sheltered and surfing beaches in the world meet tame quokkas on rottnest island fishing beach or boating surfing in perth boads windsurfing or boogieboading sailing a list of perth yacht clubs checkout the live surf cam perth before you go to a perth beach tour the historic fremantle prison after a swim at bathers beach fremantle perth house services furniture perth furniture store perth the recommened best perth office furniture store is in osbourne park dan home renovation services perth perth renovation services affordable perth office renovation services office fitouts perth recommended and affordably priced perth office fitout businesses with good google reviews is absolute office comforts office fitout services in perth business services perth web designer perth use local pwd perth web designers and web wizzards expert affordable one week to build local perth web design services business consultants perth multilingual international trade consultant perth domain name registration comercialisation of innovation australian trade mark registration business advice perth business coach planning perth business broker perth business opportunity vr video production bookkeeping services video marketing perth popular perth influencers network marketing trade shows advertising agencies marketing consultant perth tourism marketing google first for hotel marketing australia video production perth photographer perth printer perth and landscape photo prints business tourism export marketing models perth modelling fashionable italian women s clothing in perth list of perth australia businesses business broker perth market research perth 2025 agm in perth sales coach perth digital marketing services perth seo perth expert best digital marketing agency perth making websites popular with affordable winning expert seo in perth by the most experienced best perth seo consultant expert pr perth for perth s best public relations services public guest speakers market research perth online advertising get your ad on this and other popular perth websites at affordable rates internet advertising agency perth marketing agency perth premium exact match perth domains for sale or lease search engine marketing perth on a pay per click or low monthly cost sales coach perth financial services marketing perth insurance perth australia business for sale perth life insurance perth personal and business loans perth by perth s best finance brokers perth property investment perth financial planner perth secret atm camera scam tax accountant perth north of river home loans perth accounting service perth latest perth news perth weather forecast news australia perth statistics perth property land for sale in perth good size big blocks of vacant land for sale in perth less than an hour s drive to from the perth cbd under 200 000 both north and south of perth near perth beaches remax real estate agency perth good property management perth wide services vacate clean and paint property maintenance online real estate agents perth also see the perth real estate agency directory office space perth affordable perth office renovation services including new office partitions house sales perth 2025 house prices perth home loans perth building services perth settlement agent perth new home builders perth second story home extension specialist building company perth insurance perth free property valuations perth apartment for sale perth apartments perth diy house sales perth save commissions and marketing costs by selling your house youself home loans perth compared to past 19 interest rates of about 6 in 2025 makes it still worthwhile to apply for a home loan yes loans perth say yes more often custom designed houses and other buildings with architects perth utilities perth gas water electricity contact phone numbers for connections disconnections and service problems perth mining companies mining consultants perth minerals processing your mine on the google mining map which is google first for google mining map mining company marketing your ad here for the best link juice on one of the most popular web sites about perth more popular than westernaustralia com 75 off the average market ppc rate 110 per year plus one off 99 setup for a nofollow text link or 365pa for a dofollow text link free ad design education in perth computer training perth computer software training perth seo training perth private schools in perth universities perth music lessons perth map location of perth high schools 2025 public holiday dates perth 2025 perth wall calendar shopping perth online shopping sell a house online yourself at current market rate perth house prices buy fall detection alarms for sale online cheap phone calls computer sales chemist perth perth escorts restaurants perth a big multicultural population in perth mostly from europe and asia has given rise to many different types of ethnic cuisine cooked with high quality western australian food and a fusion of ideas makes for a gourmet of delicious dining experiences traditional spanish cuisine mobile paella catering service in perth that will come to your function be it a party or business event in perth google map of perth restaurants cafes in perth indian restaurants perth chinese restaurants perth italian restaurants perth vietnamese restaurants thai restaurant perth restaurant advertising perth photos of perth 360 photos of perth photographer perth videos of perth and video production see and photograph wa wildflowers during perth s wildflower season in spring perth maps street map of perth outer perth map getting to from perth airport google map of perth map of wa mining map maps of the world holiday map map of bali map of singapore map of thailand beach hotel perth social media links perth pinterest perth business opportunity scarborough beach hillays boat harbour sunset coast perth s northern suburb beaches trades engineering services perth find local perth tradies near you free tradie online advertising tv aerial installation perth new 4k tv you ll need a new digital tv anetnna installation in perth for optiamal picture quality phone chris the perth tv aerial expert on phone number 0477 696 401 it support computers perth computer training perth computer sales perth low interest rate business loans in perth for tradie equipment for the best gardening services in perth hire a good local gardener in perth s northern suburbs for expert gardening services cheap storage perth alternativly hire or buy cheap used 20 or 30 sea containers for sale in perth sold by wa container services who also do sea container conversions in perth into a tiny house or portable office furniture stores osborne park local good handyman tradie in perth northern suburbs work from home perth search to find a local perth tradie near your perth location a new website for tradie marketing and finding tradies online advertising for small perth building companies best bricklayer perth healthcare marketing perth medical marketing perth emergency fall alarm online sales worn by the elderly a good gift idea by a family owned business based in perth knee replacement perth stop chronic knee pain in perth book an appointment for expert perth knee replacement consultation with a leading perth orthopaedic surgeon if you have chronic knee pain from arthritis or perth knee injury expert orthopaedic surgery perth spesialising in hip surgery and shoulder surgery including amazing new 3d printed drill bit guides for personalised perfect fit shoulder replacement surgery in perth shoulder pain treatment in perth book an appointment with an orthopaedic surgeon in perth who spcialises in hip and shoulder injury treatement with hip or shoulder surgery in perth wa contact the best agency for perth ndis support services if you need disability or perth aged care services lymphatic drainage massage perth treatment services retirement villages perth dentists perth best dental implants perth s western suburbs teeth whitening perth hospitals perth list see clinic locations of doctors perth on google map chemists perth get online supplies of vitamins and health products hotels near perth perth s popular northern suburb of bali 3 hours flight from perth hotels singapore 5 hours flight north of perth mandurah a satelite city 1 hours drive south of perth 3 hours south of perth is the popular western australian holiday town of dunsborough samui is the best holiday destination during the green season while the rest of thailand is wet broome popular winter holiday destination in the northwest of wa dubai holiday stopover perth to europe bangkok is 6 hours flight time north of perth to the capital city of thailand kl air transport hub of airasia phuket thailand popular tourist holiday destination for perthites krabi is the best tourist destination in thailand thai engish speaking guide perth perth beaches photo of a northern perth beach near a big new 300 boat pen marina australian rules football perth surfing perth perth s best beach poll fishing perth cycling perth perth yacht clubs business travel perth airport all airlines perth airport world links mapgoogle com world s best beach holidays mcg corporate box hire 2025 best brisbane businesses female escorts perth male escort service perth escort advertising online photos of perth perth car transport transport wa used cars for sale best limo hire perth services perth airport perth taxis fuel watch car loans perth mobile mechanic perth wide services new suv cars perth print version pdf of a list of perth s best 2025 businesses top perth businesses 2025
Thumbnail images (randomly selected): * Images may be subject to copyright.GREEN status (no comments)
  • Swan River Perth
  • Perth map
  • Scarborough Beach Perth
  • Fringe Festival Perth
  • Kangaroos in Perth
  • Best guided Perth to Swan...
  • accommodation Perth
  • Tame quokkas Rottnest Isl...
  • History of Perth
  • Good home renovation serv...
  • House and land sales Pert...
  • Mining Companies Perth
  • Perth business Events Cal...
  • mobile Spanish paella che...
  • Online advertising for sm...
  • TV antenna installation P...
  • IT Computers Perth
  • ACL pain, ACL surgery Per...
  • shoulder surgery Perth
  • Dental implant prices Pe...
  • Perth beach
  • Nice beautiful escort ser...
  • Photo Perth skyline
  • Surfing Perth

Verified site has: 81 subpage(s). Do you want to verify them? Verify pages:

1-5 6-10 11-15 16-20 21-25 26-30 31-35 36-40 41-45 46-50
51-55 56-60 61-65 66-70 71-75 76-80 81-81


The site also has references to the 1 subdomain(s)

  perth.perthperth.com  Verify


The site also has 129 references to external domain(s).

 perthx.au  Verify  perthbusiness.sale  Verify  housesaleperth.com.au  Verify
 mapperth.au  Verify  australiamap.au  Verify  google.com  Verify
 scarboro.info  Verify  perthbeach.com  Verify  accommodationperth.info  Verify
 accommodationnear.com  Verify  4webmarketing.biz  Verify  beachhotelperth.com  Verify
 toursperth.tours  Verify  winetoursswanvalley.com.au  Verify  hillarys.au  Verify
 cyclingperth.com  Verify  youtube.com  Verify  sites.google.com  Verify
 restaurantperth.rest  Verify  fishingperth.fishing  Verify  winch.boats  Verify
 surfingperth.com  Verify  sailingperth.com  Verify  perthfurniture.store  Verify
 absoluteofficecomforts.com.au  Verify  renovationperth.services  Verify  perthrenovation.services  Verify
 perthofficefitout.com.au  Verify  webdesignerperth.com  Verify  perthweb.design  Verify
 webwizards.com.au  Verify  tradeconsultant.au  Verify  domainnameregistrationaustralia.com  Verify
 businesssale.biz  Verify  vrvideos.video  Verify  seoperth.expert  Verify
 advertisingagencyaustralia.com  Verify  photographerperth.info  Verify  dxprintingperth.com.au  Verify
 landscapephoto.au  Verify  theitaliancloset.com.au  Verify  digitalmarketingperth.com  Verify
 sitepopularity.biz  Verify  prperth.com  Verify  financialservicesmarketingperth.au  Verify
 allnationfinance.com.au  Verify  homeloansaustralia.info  Verify  financialplannerperth.com  Verify
 accountantperth.com  Verify  homeloansperth.info  Verify  perthnews.info  Verify
 bom.gov.au  Verify  newsaustralia.info  Verify  landsaleperth.land  Verify
 remaxexchange.com.au  Verify  perthproperty.management  Verify  vacatecleanandpaint.com.au  Verify
 realestateperth.agency  Verify  perthrealestate.agency  Verify  settlementagentperth.com  Verify
 builderperth.com  Verify  homeextensionperth.au  Verify  propertyvaluationperth.com  Verify
 miningconsultants.net  Verify  perth.training  Verify  perth.shopping  Verify
 personalalarm.sale  Verify  cheapphonecalls.org  Verify  chemistperth.com  Verify
 escortsau.com.au  Verify  paellaperth.au  Verify  indianrestaurantperth.com  Verify
 chineserestaurantperth.com  Verify  italianrestaurantperth.com  Verify  vietnameserestaurantperth.com  Verify
 thairestaurantperth.com  Verify  goo.gl  Verify  flowersaustralia.info  Verify
 perthmap.au  Verify  mapwesternaustralia.com  Verify  miningmap.au  Verify
 mapgoogle.org  Verify  mapbali.info  Verify  accommodationsingapore.info  Verify
 mapthailand.asia  Verify  pinterest.com.au  Verify  tradie4u.services  Verify
 tvantennainstallationperth.au  Verify  telewest.com.au  Verify  itsupportperth.support  Verify
 computersalesperth.com  Verify  gardenerperth.com.au  Verify  storageperth.store  Verify
 seacontainersaustralia.com.au  Verify  wacontainerservices.com.au  Verify  perthtradie.au  Verify
 builderperth.builders  Verify  bricklayerperth.au  Verify  medicalmarketingperth.au  Verify
 guardianpa.com.au  Verify  aclsurgeryperth.au  Verify  perthkneereplacement.com.au  Verify
 perthorthopaedicsurgery.com  Verify  perthkneeinjury.com.au  Verify  shouldersurgeryperth.au  Verify
 perthndis.support  Verify  perthaged.care  Verify  lymphaticdrainageperth.au  Verify
 dentalimplantsperth.dental  Verify  accommodationbali.info  Verify  accommodationmandurah.com  Verify
 hoteldunsborough.com  Verify  hotelssamui.mobi  Verify  broomeaccommodation.info  Verify
 hoteldubai.info  Verify  klhotelkl.com  Verify  phuketthai.land  Verify
 hotelkrabi.biz  Verify  wafl.com.au  Verify  bestbeachholidays.info  Verify
 mcgcorporatebox.melbourne  Verify  perthescort.services  Verify  escortad.online  Verify
 photos.app.goo.gl  Verify  transportwa.com.au  Verify  lavishlimousines.com.au  Verify
 fuelwatch.wa.gov.au  Verify  mobilemechanicperth.mobi  Verify  drive.google.com  Verify


Top 50 hastags from of all verified websites.

Supplementary Information (add-on for SEO geeks)*- See more on header.verify-www.com

Header

HTTP/1.1 301 Moved Permanently
Content-Type text/html; charset=UTF-8
Location htt????/perthperth.com/
Server Microsoft-IIS/10.0
X-Powered-By ASP.NET
X-Powered-By-Plesk PleskWin
X-Frame-Options ALLOW-FROM htt????/docs.google.com
Date Mon, 25 May 2026 03:31:52 GMT
Connection close
Content-Length 146
HTTP/2 200
content-type text/html
content-encoding gzip
last-modified Thu, 30 Oct 2025 03:40:53 GMT
accept-ranges bytes
etag 8010e2fd4e49dc1:0
vary Accept-Encoding
server Microsoft-IIS/10.0
x-powered-by ASP.NET
x-powered-by-plesk PleskWin
x-frame-options ALLOW-FROM htt????/docs.google.com
date Mon, 25 May 2026 03:31:53 GMT
content-length 15145

Meta Tags

title="Perth Western Australia, 2025, Tourist, Business Information"
charset="utf-8"
content="IE=edge" http-equiv="X-UA-Compatible"
content="width=device-width, initial-scale=1" name="viewport"
content="2025 list of Perth's best tourist attractions and business information about Perth Western Australia. Contact Perth WA businesses websites / phone numbers." name="description"

Load Info

page size15145
load time (s)2.147215
redirect count1
speed download7054
server IP 203.98.70.63
* all occurrences of the string "http://" have been changed to "htt???/"