If you are not sure if the website you would like to visit is secure, you can verify it here. Enter the website address of the page and see parts of its content and the thumbnail images on this site. None (if any) dangerous scripts on the referenced page will be executed. Additionally, if the selected site contains subpages, you can verify it (review) in batches containing 5 pages.
favicon.ico: thelightshow09.blogspot.com - THE LIGHT SHOW.

site address: thelightshow09.blogspot.com

site title: THE LIGHT SHOW

Our opinion (on Wednesday 03 June 2026 3:25:11 UTC):

GREEN status (no comments) - no comments

Meta tags:

Headings (most frequently used words):

tls09, light, 2009, the, show, may, tls, lau, monday, 18, wednesday, about, links, featured, on, blog, archive, followers, love, and, welcome, lightness, of, being, celebrated, by, seven, skins, bernard, chauly, carolyn, fabian, tan, farah, azizan, jazmi, izwan, jamal, lisa, foo, loh, kok, man, mah, su, sim, richard,

Text of the page (most frequently used words):
the (219), and (194), light (79), with (59), for (52), tls09 (43), that (42), are (31), from (30), 2009 (24), dance (24), show (23), plastic (21), this (21), lau (18), art (18), his (18), design (17), foo (17), has (17), our (17), she (17), out (16), into (16), lighting (16), when (15), bottles (15), was (14), posted (13), made (13), have (13), were (13), designer (13), material (13), what (13), arts (13), lisa (12), carolyn (12), lights (12), more (12), her (12), not (12), can (11), objects (11), there (11), also (11), theatre (11), found (11), comments (11), but (11), who (11), been (11), man (10), some (10), film (10), all (9), richard (9), like (9), malaysia (9), new (9), sim (8), kok (8), exhibition (8), people (8), working (8), they (8), world (8), installation (8), interactive (8), such (8), now (8), would (8), mah (7), farah (7), azizan (7), tan (7), bernard (7), recycled (7), which (7), one (7), way (7), environment (7), director (7), just (7), waste (7), water (7), these (7), work (7), think (7), energy (7), music (7), works (7), between (7), will (7), may (6), featured (6), about (6), how (6), sculpture (6), discards (6), bags (6), creative (6), most (6), yet (6), landscape (6), architect (6), series (6), spaces (6), performance (6), since (6), each (6), oil (6), used (6), jazmi (5), fabian (5), chauly (5), seven (5), love (5), life (5), gallery (5), finding (5), lfss (5), different (5), fused (5), together (5), best (5), materials (5), currently (5), artists (5), only (5), much (5), set (5), recycling (5), less (5), project (5), sculptures (5), using (5), use (5), where (5), college (5), body (5), idea (5), sound (5), artist (5), their (5), its (5), five (5), well (5), aida (5), redza (5), loh (4), being (4), annexe (4), making (4), kuala (4), lumpur (4), process (4), end (4), however (4), bag (4), always (4), few (4), another (4), aswara (4), form (4), interest (4), maker (4), came (4), designers (4), other (4), mainly (4), artistic (4), passion (4), find (4), forms (4), soft (4), stage (4), aesthetic (4), create (4), thought (4), last (4), time (4), part (4), pet (4), low (4), lamps (4), international (4), surface (4), movement (4), visual (4), straws (4), technology (4), kunang (4), uses (4), multimedia (4), soda (4), make (4), glass (4), computer (4), than (4), living (4), childhood (4), centre (4), future (4), things (4), krishen (4), bulb (4), degree (4), sukarji (4), anne (4), james (4), created (4), ways (4), izwan (3), jamal (3), skins (3), klue (3), play (3), tls (3), disciplines (3), humour (3), inspire (3), producers (3), called (3), clear (3), free (3), join (3), nothing (3), house (3), early (3), age (3), say (3), mundane (3), mother (3), production (3), department (3), later (3), upon (3), own (3), looks (3), mineral (3), scale (3), eco (3), while (3), still (3), crafting (3), tools (3), over (3), natural (3), craft (3), after (3), experience (3), creativity (3), creates (3), exploring (3), boh (3), cameronian (3), awards (3), 2006 (3), 2007 (3), same (3), year (3), days (3), drinking (3), leds (3), sea (3), creatures (3), dark (3), deep (3), see (3), many (3), public (3), discarded (3), fireflies (3), based (3), human (3), university (3), installations (3), industrial (3), granted (3), national (3), architecture (3), inspired (3), architects (3), ago (3), should (3), guli (3), malaysian (3), remember (3), perhaps (3), china (3), event (3), renewed (3), food (3), convenience (3), mount (3), tins (3), planet (3), value (3), support (3), jit (3), astro (3), again (3), muzium (3), lampu (3), change (3), innovative (3), hardesh (3), singh (3), sriman (3), contemporary (3), pieces (3), choreographed (3), performed (3), shafirul (3), first (3), might (3), any (3), need (3), even (3), became (3), popular (3), celebrated (2), welcome (2), lightness (2), witness (2), rogueart (2), started (2), minded (2), cajole (2), home (2), comment (2), headlights (2), surrounded (2), challenge (2), resist (2), once (2), interesting (2), junk (2), potential (2), carried (2), away (2), your (2), encouraged (2), look (2), real (2), worked (2), revived (2), whilst (2), abbreviation (2), both (2), glance (2), appropriately (2), spells (2), intention (2), bottle (2), consumer (2), today (2), commercial (2), functional (2), maintaining (2), inherent (2), quality (2), ethereal (2), whether (2), treasure (2), sources (2), inspiration (2), lives (2), luminous (2), exist (2), recently (2), friend (2), features (2), reduce (2), hard (2), nature (2), expression (2), patterns (2), garden (2), special (2), humble (2), action (2), 2003 (2), founded (2), pentas (2), cultural (2), won (2), category (2), award (2), institute (2), full (2), singapore (2), bringing (2), turning (2), everyday (2), delight (2), response (2), transformation (2), spirit (2), saving (2), amazing (2), blue (2), fascination (2), city (2), expected (2), beyond (2), europe (2), 2008 (2), architectural (2), space (2), assemblage (2), nurturing (2), culture (2), softscape (2), medium (2), projection (2), paper (2), sounds (2), projected (2), random (2), during (2), night (2), power (2), producing (2), received (2), hons (2), majoring (2), member (2), performing (2), mobile (2), social (2), drumlight (2), floor (2), mounted (2), drums (2), inter (2), factory (2), heart (2), crates (2), empty (2), held (2), pop (2), brands (2), cola (2), high (2), blurring (2), 2001 (2), london (2), yellow (2), pages (2), had (2), joined (2), seksan (2), gdp (2), birth (2), long (2), movies (2), terrified (2), electrolyte (2), skin (2), feel (2), nostalgic (2), game (2), marbles (2), myself (2), wants (2), hope (2), cheeky (2), god (2), creations (2), coasters (2), believes (2), kitchen (2), assortment (2), guard (2), trying (2), forget (2), washed (2), lit (2), reflective (2), daily (2), nourishment (2), source (2), quickly (2), wish (2), them (2), throw (2), old (2), fund (2), makes (2), small (2), collection (2), down (2), recycle (2), vegetable (2), could (2), forward (2), initiatives (2), major (2), two (2), yes (2), significant (2), 100w (2), bulbs (2), earth (2), options (2), combat (2), climate (2), possible (2), around (2), usa (2), include (2), memorable (2), collaborations (2), fluorescent (2), june (2), thanks (2), germany (2), films (2), wearing (2), soul (2), others (2), bachelor (2), indonesia (2), program (2), dancer (2), choreographer (2), angin (2), suhaili (2), dancers (2), teaching (2), various (2), micheline (2), ahmad (2), kamil (2), azmi (2), suhaimi (2), loves (2), hailizan (2), mahmoon (2), eyes (2), day (2), without (2), discovering (2), took (2), chi (2), wei (2), going (2), through (2), green (2), efficient (2), chance (2), interaction (2), ann (2), lee (2), brought (2), rise (2), white (2), turns (2), malaysians (2), take (2), then (2), here (2), limiting (2), shows (2), quiet (2), presents (2), next (2), head (2), galeri (2), tenaga (2), admission (2), 10am (2), thursday (2), along (2), good (2), object (2), participants (2), driven (2), skip (2), rights, reserved, image, copyright, followers, blog, archive, luct, limkokwing, students, creation, second, edge, emmagem, shine, links, view, complete, profile, information, please, email, tlsers09, gmail, com, subscribe, posts, atom, assorted, shopping, ppe, pep, etc, fusing, layers, melted, hot, iron, result, tough, sheet, diffuse, coloured, piles, possibilities, scrap, endless, exhilaration, great, thing, reinvention, frustrating, figure, shape, reluctant, operate, never, accept, philosophy, quite, roadside, seeing, sets, juices, flowing, drawbacks, namely, chosen, cleaned, don, smell, rot, you, get, impulse, collect, becomes, garbage, dump, scavengers, looking, perspective, lectures, born, 1961, grew, decided, escape, pursue, course, humanities, england, discover, returning, builder, prop, across, raw, brut, abroad, resonated, undeniably, ubiquitous, examples, exercises, wares, manufacturers, opposite, bit, greener, cultivating, conscientious, attitude, thus, aimed, purposing, throughout, applying, basic, manual, skills, domestic, stationery, aspire, generate, worth, charm, field, years, nurtured, designing, leisure, chest, bursting, enrich, spills, radiate, abstract, representations, blueprints, live, flora, teamed, fashioned, branded, themselves, convey, message, perceives, fluid, revitalizing, extensions, structures, modeling, exterior, sculptural, elements, splendid, simply, resolute, integrating, aesthetics, functionality, evoke, calming, restorative, owns, oasis, assumes, responsibilities, relies, requires, refinement, accuracy, discretion, effects, longer, servant, meaning, thoughts, transition, winner, chinese, script, untitled, 2005, went, york, months, asian, council, fellowship, phoenix, rises, 5th, lost, ecliptic, 6th, ceacar, chong, ismail, established, actor, graduated, 1993, lecturing, drama, visuals, era, development, instructor, hands, percussions, drummers, aku, 1997, traveled, japan, korea, india, sharing, continents, mysterious, problem, thousands, transformed, individual, employing, embodied, emphasized, reduction, consume, mighty, rule, depths, mystical, realm, given, miss, landlubbers, rarely, bioluminescence, abyss, seascape, indulgence, experimentation, seeking, een, publications, australia, hong, kong, collaborated, exhibited, depicting, formed, effort, spread, awareness, persistent, innovator, emma, designed, completed, founder, fota, approach, concerned, experimenting, marries, objective, indoor, playground, imaginative, innovation, mapping, office, detected, sensors, camera, triggers, rhythmic, onto, colors, appear, emerge, user, comes, proximity, whole, share, beauty, represented, mapped, curtain, basically, unwanted, element, personal, digital, media, generative, experimental, musicians, cooperative, emacm, alumnus, asia, foundation, asef, favorite, gadgets, researching, site, specific, interventions, dealing, implications, emergent, technologies, group, standing, suspended, assembled, retain, mass, produced, module, replicated, comprises, utilitarian, furniture, connecting, functions, opportunity, chanced, derelict, filled, ceiling, forsaken, trove, ranging, obscure, peacock, sinalco, stacked, precariously, tower, blocks, trapped, zinc, roofed, cavern, guarded, solitary, pakcik, access, via, skillful, negotiations, worthy, politician, thank, him, cleared, likely, pave, consumerist, monument, seemingly, ambiguous, cityscape, 2000, pursued, diploma, riba, association, urban, ecologies, post, landscapes, boundaries, recent, chair, recordings, conversations, sinister, advertisers, graduating, 2004, freelanced, reluctantly, returned, looked, back, obtained, nottingham, artwork, signifier, creepy, evolution, intrigued, mankind, observing, lately, seems, assimilating, profusely, reliance, computers, heavier, ever, emails, internet, networks, games, softwares, laugh, notion, terminator, witnessing, slow, remind, emergence, breathing, entity, whirl, represents, veins, behind, beware, represent, fusion, abandoned, wooden, magic, experiment, involving, almost, extinct, child, stare, hypnotized, swirls, colours, floating, relative, virgin, maintain, naivety, digress, fantasies, fresh, concepts, corner, title, petronas, showcasing, emerging, participated, feast, beijing, parallel, entitiled, retrospective, kyoorius, designyatra, latest, roller, vintage, drink, golden, animals, wheels, star, newspaper, magazine, fashionable, definitions, pushed, existing, limitations, resultant, offerings, intends, nurture, lampshades, whisky, beside, deserted, apt, bases, implying, futile, inebriation, metaphorically, regarding, clean, perforated, linked, stitched, potentials, explored, glowing, shadow, casting, colouring, reworking, repeated, components, relives, routine, consumption, comprise, household, ready, solicit, contemplation, yoghurt, milk, cartons, jars, packets, frugality, resourcefulness, dexterity, simple, children, large, doses, help, survive, uncertain, half, frugal, botol, cruised, neighborhoods, buy, bread, reused, toys, enjoyably, hand, magazines, reformed, bead, curtains, largely, undervalued, forgotten, why, discard, litter, because, those, hold, assumed, taken, memories, watching, parents, clothes, canoes, pots, fishing, nets, traps, chicken, coops, jewelry, gifts, gardens, previously, dabbled, costume, receiving, honour, partner, affiliate, company, sd2, sdn, bhd, pedestrian, trigger, precious, laughs, whenever, cook, told, pour, cooking, drain, illegal, agrofuel, cars, biofuels, forests, plant, palm, agro, fuel, steps, president, barack, obama, biggest, polluters, america, partnership, battle, against, global, warming, phasing, heard, traditional, 100, watt, incandescent, phased, favour, alternatives, save, hear, difference, too, late, fairy, dangle, tree, dataran, merdeka, before, display, banned, excessive, wastage, electricity, commemorate, historic, agreement, litre, converted, biofuel, surviving, highlights, selamat, datang, studied, universiti, sains, goldsmiths, credits, gol, gincu, goodbye, boys, finishing, third, feature, pisau, cukur, cinemas, creator, especially, janet, pillai, rama, sita, generasi, baru, family, staged, berlin, proud, zha, teater, muda, 1999, puppet, toured, badminton, courts, dbkl, flats, milo, likes, wattage, thinks, halogen, spots, recommended, favourite, dedo, diva, joseph, gonzales, marion, cruz, producer, turned, technopreneur, holds, telecommunications, engineering, soundworks, productions, carving, name, himself, locally, internationally, albums, local, rock, remix, release, festivals, scored, numerous, commercials, winning, mask, burn, interact, master, fine, smith, jakarta, center, malaya, appointed, coordinator, known, javanese, classical, globally, including, circle, bliss, darkness, awakening, manuhara, nourishments, helps, noticed, thirst, aged, actively, kids, teaches, aurora, school, earned, victorian, melbourne, perform, sadly, very, opportunities, reacting, independent, enjoys, studying, choreography, sing, splendoured, open, comforting, beacon, harsh, reality, reflecting, cannot, imagine, void, spirited, true, certain, somewhere, odissi, 1992, finally, plunge, learning, ramli, ibrahim, decade, sutra, seen, donna, miranda, extended, periods, waiting, central, market, zulkifli, mohamad, selipar, jepun, cabaret, performer, stor, dbp, interacting, lancelets, headgear, selendang, lighttorchchandeliertaperbeacon, sparkleglistenfireflyflickerreflectionglowwormdaylight, sunbeammoonshinehalonimbusauranebulalightningcandle, raysflareflameglimmershimmertwinkle, radiantshinelustersheenglowincandescenceafter, glowluciditybrightsplendorglareblazeblindingbeamsolar, acting, happy, snatch, theft, victim, political, turmoil, march, necessary, cleansing, convinced, come, period, nation, illuminating, resonating, romance, embodiment, prominent, performers, unique, backgrounds, amidst, web, team, presented, choreographic, challenges, spreading, senses, candle, emanating, dependance, wild, flowers, hair, whose, example, tight, bound, tradition, deconstruction, interdisciplinary, principles, happening, intervention, within, videography, nazim, esa, managed, costumes, uhaili, rehearsal, mostly, writer, playwright, divides, history, science, medicine, excerpts, catalogue, appropriate, times, near, far, transparency, politicians, innocents, angels, murkier, intents, streetlamps, cctv, cameras, seem, cast, rising, crime, rate, lava, exactly, passé, plasma, globes, launch, anything, losing, bear, ruled, land, solo, monotonous, morning, bungalow, apartment, block, room, boardroom, security, pondok, stesen, keretapi, sure, hardy, tubing, unbeatably, cheap, lasting, relief, least, warm, cool, tone, hours, inside, outed, events, developers, ikea, afford, enjoy, variety, package, paint, colour, feeling, move, does, none, gone, call, bangladeshi, polemic, wears, environmentalism, often, tedious, smug, ideology, conviction, face, scientific, consensus, humans, impact, complacency, pussycat, purr, caress, carbon, footprint, trading, intellectual, peril, cycle, rescue, deeply, conservative, ethos, restraining, order, hippy, laidback, meanwhile, beginning, snuff, irrespective, mortal, efforts, integrity, instances, ample, evidence, adept, range, environmentally, conscious, footed, leaden, bastardized, beautiful, fashioning, emitting, diodes, combinations, artificial, preoccupations, elegant, startling, affects, interiors, wit, clarity, plain, persuasive, bright, minds, divisions, discipline, viewed, audiences, appearing, soon, greatest, 1920s, fascinated, prospects, famously, dusseldorf, three, month, images, attended, millions, arena, filmmaker, providing, evocative, insight, heritage, private, taste, predilection, bravura, extravaganzas, surprises, sometime, fuse, confident, flair, fear, line, must, deal, debris, unbridled, consumerism, charming, provocative, imagination, sofa, harnessed, strong, conceptual, practical, twist, sees, adroitly, ingenuity, sip, folks, derived, joy, behold, suggest, migrants, migraines, detritus, present, duo, continues, intriguing, shapes, deeper, earlier, visits, marine, diversity, heads, lampshade, apron, headpiece, raft, surely, signs, progress, tiny, solution, scheme, sum, praise, regret, epic, hopefully, annual, extend, sites, wherever, though, rare, indeed, examining, know, congratulations, balai, seni, lukis, negara, exhibitors, mon, fri, 5pm, sat, 2pm, saturday, wisma, tnb, petaling, jaya, 11am, 7pm, april, sunday, wednesday, earn, brownie, points, promoting, mantra, reuse, manages, achieved, goal, contributing, creatively, towards, journey, moving, alone, scarce, enough, deepest, gratitude, generous, sponsors, supporters, enabling, realise, rewarding, particularly, results, absolute, icing, cake, easy, coupled, label, sits, comfortably, regardless, enable, expand, perceptions, already, difficult, number, traditionally, disparate, board, spatially, emotive, experiential, ephemeral, add, instinctively, preferred, tls09ers, mix, seeds, sown, www, surfing, ogling, corners, thinking, walk, talk, serendipity, word, carries, positive, connotations, everyone, behalf, monday, explores, upcycling, sidebar, main,


Text of the page (random words):
d by tls09 at 9 30 pm no comments tls09 carolyn lau carolyn lau is a landscape architect with seksan design and partner of affiliate company sd2 sdn bhd she has previously dabbled in set costume and lighting design for theatre receiving support from the krishen jit astro fund makes her feel like she s working with krishen again what an honour childhood memories are of watching her parents making food tools sculpture clothes canoes pots bags fishing nets traps chicken coops jewelry gifts gardens nourishment 2009 why do people discard and litter so much because those things hold no value to them convenience is expected assumed taken for granted the craft of frugal living where the botol man cruised neighborhoods to buy used glass and tins where plastic bread bags were washed out and reused where toys were enjoyably hand made with much make do where old magazines were reformed into paper bead curtains is now largely undervalued if not forgotten i am nostalgic for that frugality for the resourcefulness dexterity and simple creativity that came with it i wish for my children large doses of it to help them survive their uncertain future as i wish for myself and half this planet so i am trying to find value in what i throw out my works for tls09 comprise of daily discards from my kitchen centre of nurturing and nourishment source of the most household waste discards that quickly mount up as ready material solicit contemplation yoghurt bottles food tins milk cartons glass jars 3 in 1 packets plastic bags washed clean perforated linked fused stitched lit up each material s potentials are explored whether reflective glowing shadow casting or colouring light reworking each material as repeated components relives the routine of our daily consumption an assortment of lampshades is mounted on empty whisky bottles which were found beside a deserted guard house apt bases implying the futile inebriation of trying to forget to remember to remember to forget metaphorically what some of us do when regarding recycling and convenience the resultant assemblage of renewed kitchen offerings intends to nurture food for thought posted by tls09 at 9 15 pm no comments tls09 fabian tan fabian tan is an architect who believes that fashionable definitions of art can be pushed beyond their existing limitations in 2008 his corner art works were featured in the working title exhibition at petronas gallery showcasing 10 emerging malaysian artists he has also participated in the man god international visual feast exhibition in beijing china and a parallel exhibition entitiled retrospective with the kyoorius designyatra event his latest creations roller coasters are vintage drink coasters with golden animals on wheels and have been featured in the star newspaper and klue magazine as a relative virgin in the art world he wants to maintain his naivety and perhaps digress into childhood humour and fantasies in hope of producing fresh and cheeky concepts in art gu light 2009 is an experiment involving an almost extinct malaysian childhood game guli or marbles i remember myself as a child who would stare into the guli and was always hypnotized by the swirls of colours floating in the glass the art works represent a fusion of abandoned wooden crates and other junk material light and guli to create a feel of nostalgic magic electrolyte 2009 the artwork is a signifier for the creepy evolution of the computer since its birth it has intrigued mankind but i have been observing lately that the computer seems to be assimilating profusely into people s life the reliance on computers is heavier than ever in this age of emails internet social networks games and softwares not long ago i used to laugh at the notion of a terminator in the movies but now i am terrified of witnessing its slow birth electrolyte should remind us of the computer s emergence as a living breathing entity the whirl of lights represents veins behind its skin beware of the computer posted by tls09 at 9 00 pm no comments tls09 farah azizan farah azizan obtained her ba in architecture at nottingham university uk and after working with gdp architects between 2000 and 2001 pursued her diploma in architecture riba part ii at the architectural association london her works are inspired by urban ecologies post industrial landscapes and the visual arts blurring the boundaries between art architecture landscape design a recent exhibition at the annexe featured a chair made of yellow pages and recordings of random conversations she had with some of its more sinister advertisers upon graduating in 2004 she freelanced in london after which she reluctantly returned to kl and joined seksan design she has not looked back since drumlight series 2009 the opportunity to make lights using glass bottles came when we chanced upon a derelict factory in the heart of industrial pj filled from floor to ceiling with crates of empty soda bottles the forsaken space held a treasure trove of soda pop brands ranging from the early 60 s to more obscure brands like peacock cola sinalco and rc cola stacked precariously high like city tower blocks trapped in a zinc roofed cavern guarded by a solitary pakcik who granted us access via skillful negotiations worthy of a national politician i thank him for my material the factory has now since been cleared out likely to pave way for another consumerist monument blurring into pj s seemingly ambiguous cityscape the drumlight series features a group of standing floor mounted and suspended lights that are assembled from oil drums and soda bottles recycled and revived to retain their industrial and mass produced aesthetic the module is replicated in an installation which comprises a set of utilitarian furniture with inter connecting functions posted by tls09 at 8 45 pm no comments tls09 jazmi izwan jamal jazmi is a malaysia based interactive designer and sound artist producing commercial and personal work he received ba hons in multimedia majoring in digital media at multimedia university malaysia his interest is mainly in interactive installations music technology and generative art he works as a creative director and sound artist he is a member of the experimental musicians and artists cooperative malaysia emacm and alumnus of the asia europe foundation asef his favorite performing tools are mobile gadgets currently he is researching site specific interventions dealing with the cultural and social implications of emergent technologies kunang kunang 2009 kunang kunang is an interactive installation based on the movement of fireflies mapped on a curtain of straws that creates an environment full of light this project basically uses an unwanted waste material plastic drinking straws as a projection surface the interactive element of this project uses human body movement random colors appear and sounds emerge as the user comes into proximity with the straws the whole idea of this interactive installation is to share the beauty of fireflies during the night represented using the power of art and technology softscape 2009 softscape is a medium scale interactive installation of a projection mapping on a soft surface made from discarded materials such as plastic bags and office paper movement when detected by sensors and a camera triggers rhythmic sounds and visual patterns projected onto the soft surface the objective of the installation is to create an indoor interactive playground for the public it can be your imaginative soft garden nurturing a culture of creativity and innovation posted by tls09 at 8 30 pm no comments tls09 lisa foo lisa foo is the co founder of fota design 2007 her architectural approach is concerned with the crafting of space and experimenting with material assemblage that marries the functional with artistic expression a persistent innovator of spaces foo s emma house in kuala lumpur designed and completed in 2006 has b een featured in many international publications in europe australia hong kong and singapore recently she collaborated with a friend and exhibited luminous eco light sculptures depicting deep sea creatures from recycled plastic drinking water pet bottles and formed lfss in 2008 in an effort to spread awareness of recycling in her indulgence for creative experimentation with found objects she is seeking for that transformation of the expected into art and beyond city of lights in seascape 2009 fascination with bioluminescence in the abyss it s a deep blue world we landlubbers rarely see mystical realm that most of us have given a miss yet amazing creatures rule the dark depths of the mighty sea in response to the problem of plastic waste in our environment each part in thousands of plastic drinking water pet bottles is transformed into individual light sculptures and an installation the idea of maintaining the inherent quality of the material and employing low embodied energy in the process of transformation is emphasized when recycling these pet bottles in the same spirit of reduction these sculptures also consume less energy by using energy saving lamps and leds turning everyday mundane waste objects into mysterious and ethereal delight lfss is the abbreviation for both the designers lisa foo mah su sim and at a glance it looks like less just appropriately spells out our intention less waste posted by tls09 at 8 20 pm no comments tls09 loh kok man artistic director of pentas project kok man is an established theatre director actor and lighting designer graduated from the malaysia institute of the arts in 1993 kok man is currently lecturing in the drama and visuals department new era college he is also the body development instructor for hands percussions full time drummers since his performance of aku in 1997 he has traveled to japan korea india and singapore bringing and sharing his work with people in these different continents he was winner for best director and best chinese script in the 2003 boh cameronian arts awards for untitled in 2005 he founded pentas project and went to new york for 6 months on an asian cultural council fellowship in 2006 he won best lighting design for phoenix rises in the dance category in the 5th boh cameronian arts award in 2007 he won best lighting design for the lost and the ecliptic in the theatre category at the 6th boh cameronian arts awards in the same year together with ceacar chong kok man was co production designer for ismail the last days light thought i 2009 stage lighting design not only relies on creativity but also requires refinement accuracy and aesthetic discretion lighting design creates an environment for performance to light the stage and to create special effects however when light is no longer the humble servant of a performance what is the meaning of light light thought i is an action and thoughts exploring this transition posted by tls09 at 8 15 pm no comments tls09 mah su sim landscape designer mah su sim perceives landscape spaces to be soft fluid and revitalizing extensions to hard structures modeling most of her exterior spaces and sculptural elements after nature s splendid expression of forms and patterns su sim is simply resolute about integrating aesthetics with functionality to evoke a calming and restorative experience she co owns oasis water garden where she assumes mainly creative responsibilities recently she teamed up with architect and friend lisa foo to craft a series of light features fashioned from recycled plastic mineral water bottles they branded themselves lfss to convey the message of re think re use and reduce eco light sculpture flora 2009 working in the field of landscape design has over the years nurtured my passion for designing whether for work or leisure i find the natural environment a treasure chest of design sources and inspiration bursting to enrich our lives this inspiration spills over into my luminous sculptures which radiate as abstract representations of natural forms that exist as blueprints of the world we live in the plastic mineral water bottle is undeniably one of the most ubiquitous examples of consumer waste today recycling exercises for these bottles into other plastic wares are mainly carried out on a commercial scale by manufacturers however at the opposite end of the scale the consumer can also do his her bit for a greener environment by cultivating a more eco conscientious attitude thus this project is aimed at re purposing plastic mineral water bottles into artistic yet functional light sculptures while still maintaining the inherent quality of the material throughout the crafting process by applying basic manual crafting skills using domestic tools and stationery i aspire to generate worth and ethereal charm out of the mundane plastic bottles lfss is the abbreviation for both the designers lisa foo mah su sim and at a glance it looks like less just appropriately spells out our intention less waste posted by tls09 at 8 10 pm no comments tls09 richard lau born in kuala lumpur in 1961 into a creative environment richard lau grew up surrounded by artists and art in one form or another richard decided to escape this environment and pursue a course in humanities in england only to discover much later that his real interest was in art upon returning to kl richard worked as a set builder prop maker designer and has also worked as an art director for film tv and theatre his interest in art was revived when he came across raw art art brut whilst abroad which resonated with his own interest in working with found objects and recycling materials richard currently lectures on production design at the film department aswara headlights 2009 my mother made me do it from an early age we were encouraged to be scavengers that s one way of looking at it another way is to say that we were encouraged to look at mundane objects from a different perspective there s nothing quite like finding interesting junk by the roadside the challenge of seeing the potential in discards sets the creative juices flowing there are a few drawbacks namely the objects chosen have to be cleaned so that they don t smell or rot also if you get carried away and can t resist the impulse to collect your house becomes a garbage dump some objects resist reinvention and it can be frustrating to figure out how to shape and join materials which are reluctant to co operate however never accept the philosophy of once a plastic bag always a plastic bag we are surrounded by piles of discards and the possibilities of working with scrap are endless the exhilaration and challenge is great and the best thing is the materials are free the headlights are made from assorted recycled plastic shopping bags ppe pep etc fused together the process is called fusing layers of plastic bags are melted together with a hot iron and the end result is a tough fused plastic sheet that can diffuse light if it is made with clear or light coloured plastic posted by tls09 at 8 05 pm 1 comment home subscribe to posts atom about tl...
Thumbnail images (randomly selected): * Images may be subject to copyright.GREEN status (no comments)

Verified site has: 17 subpage(s). Do you want to verify them? Verify pages:

1-5 6-10 11-15 16-17


The site also has references to the 2 subdomain(s)

  lfss-create.blogspot.com  Verify   art2play.blogspot.com  Verify


The site also has 27 references to other resources (not html/xhtml )

 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R___.jpeg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify
 blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify  blogger.googleusercontent.com/img/b/R2___.jpg  Verify


Pages verified in the last hours (randomly selected):


Top 50 hastags from of all verified websites.

Supplementary Information (add-on for SEO geeks)*- See more on header.verify-www.com

Header

HTTP/1.1 200 OK
Content-Type text/html; charset=UTF-8
Expires Wed, 03 Jun 2026 03:25:11 GMT
Date Wed, 03 Jun 2026 03:25:11 GMT
Cache-Control private, max-age=0
Last-Modified Thu, 05 Sep 2024 19:27:42 GMT
ETag W/ 5078618ac156ca90b202d97320560802886d3df27af768f111bef489018a4db4
Content-Encoding gzip
X-Content-Type-Options nosniff
X-XSS-Protection 1; mode=block
Content-Length 31384
Server GSE
Connection close

Meta Tags

title="THE LIGHT SHOW"
content="text/html; charset=UTF-8" http-equiv="Content-Type"
content="blogger" name="generator"
content="htt???/thelightshow09.blogspot.com/" property="og:url"
content="THE LIGHT SHOW" property="og:title"
content="LIGHT SCULPTURE EXHIBITION EXPLORES ON THE IDEA OF UPCYCLING" property="og:description"
name="google-adsense-platform-account" content="ca-host-pub-1556223355139109"
name="google-adsense-platform-domain" content="blogspot.com"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgessK0kCLE5ovh-AXx-kY7M5SmfzGBvGq_rn-Ly2tAhIE8htku7GumFHnlInL40cy7SjjrTx_DTOU__fr0ZHk-azWPmcMATzdR0uRZ4xA-7J7necxsGa5fjMyIoSieW0CHNJ4ju6Z5Mnbk/s400/TLS09.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="381501306538222933" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-love-and-light.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiDDBmIXIbEyUByYcp5bFrVBPp0TQ3h0i8ZqnrOy5TPP3nq8ZtjVC7yNLEhIP7vE-QVva7MX315DABKh6fBrSYktcG7y8nDo6Pqb3elMjVhmMmmS06zbLYoFXoNoP4I5wLb7zP704QCaeEn/s400/tls+front.jpeg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="5531813476854214536" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/light-show-2009.html" itemprop="url"
content="9137002448263389497" itemprop="blogId"
content="7531212065181862447" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-welcome-lightness-of-being.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiayYV7FCFrR2hnYdDH1HcUpLN0ttdsNuF5iUvR5v7SDOAUQkOdTUAKUvWo8Sa1P22FNogDI1KAsDMAPJFqYaGbA-RvdsT7JucTsVPS9q3tNCa0TFxwEtC6jXBXFw-E207lu624_lWQz0vm/s400/seven+skins.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="462058955054556110" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-performance-by-seven-skins.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhpj-Iam4JS8Moo6l7g9mEhm0-u3wH3O1KmcwqNqTaHgA2F7w1pvGU3EFeMRvGOTJF7TCwuD6yY6c-l-tX2KEnTniSJ-haugOyFdFTnyWJ4l2dYsaUwa1g6lM6naCp0juYfxxQewDLXPbOJ/s400/bernard-all1.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="5394479410677187811" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-bernard-chauly.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjkEA3LVGbvwORobYnvObiNrbsViezT_7Spz-FrsUMHD0E032KK1yixGtXPBqTdlpO5Yt66UIPqCqyu-IjH3mr9cMtOWXzQwakwnb0RsOLCMa4Px24qYkmbOes7wukMFxx7731QDfSyAdj8/s400/carolyn2.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="1294997394475742827" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-carolyn-lau.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjYC4g48fdUknQ1jJAE_ts7f9X50C7zSsuflJUVH01IPZz4Qj-_067V4QhETgCtxEgM9VJdjsqcw51RsqEGgiuChnphhTDixaw-Q0IfXIlr5JSi8BUgVwz7QBCGlQAvVYfi7ZaFdi_64t-r/s400/3186_91824743486_664118486_2518435_2588898_n.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="7781333517825240144" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-fabian-tan.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj-nh4aGzdwXtcEpI5oiMbN-Xjkm6czFv4aDo4K-pFQFz3CwZsnWYx7tHmJjugwyrBfPkzbzidTveRb4LH-uUAvMU8TiVSadVK65qagATbii4yoEj4G1fOwyzQm46iNyady8dfC9EWomDbZ/s400/n705857904_2340063_8093375.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="4141126611721298071" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-farah-azizan.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh3bjCx-p1ktWvUylLORnF0P3UAT5ITMxxdt0e7eblg8qpME_4SeE1Yd_RZDxIBgqVRBfjVrIRp_HV8xjvXy35sU5hkX1sVOfjObcHxvykKEOTsHd1Q3lrqfN_4F4mbAywKDKKfFFPIR_N6/s400/jazmi1.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="339072372985992865" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-jazmi-izwan-jamal.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgqpo8WBA4HCoH40u4H3lvhjnVgfInqGJZvCya_J1Hws2KiC6_EA6DtgzHN3PJHrAtV8k6zURfwU-UXUgNnIg57apLIOxL5_1hpYIhxqGrr-hNeI_8yTZrKdrKOgVtnMwxR7SfobQ0mfAXs/s400/3186_91740273486_664118486_2517493_4819624_n.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="8534574268553076256" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-lisa-foo.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEikRONwjzs-OOChRWcmFrT0RUnWuXF3anne_bB4ytkMXh4wt9hP7RaNFGpeU8BZO3BzT05_G1srAceEdPJg_DGtZ5vGNzLpXkMqqay-JdfGEr1ld70aPwjTM0UWNWIVXLyWf9TXOjrEKpZL/s400/kokman.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="395117919884851008" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-loh-kok-man.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhQYokyoZFQ-pKPz7d-oJFWGBPYsF-3M4ucVLLE_r2vLf1YdzMcXpmoIRiAC3HFOtNmQ1W_Mv8sQEA510ht9q4vubAGLfc9x6xzAw6aEUJkNSlWglgHDhDWeQ94564kqyy3KFLEQ0NIi4wn/s400/3186_91745528486_664118486_2517585_2534317_n.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="2000723537811617352" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-mah-su-sim.html" itemprop="url"
content="htt????/blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi72tIXBacyiiJqbAAxY1Tb2PPvJhxivXo7KfeYTlOfdlRcQ88dJrDgZVcETjP2oRNL3Jf8q5jY-a6foCD20MEq9nY5ufbRTUBaZD6gNz-1GWQpIMZpAQ08gDtDkeKYeZNX-_evhNjAlvrR/s400/richard.jpg" itemprop="image_url"
content="9137002448263389497" itemprop="blogId"
content="6135210974208563572" itemprop="postId"
content="htt????/www.blogger.com/profile/14484323851347249398" itemprop="url"
content="htt???/thelightshow09.blogspot.com/2009/05/tls09-richard-lau.html" itemprop="url"

Load Info

page size31384
load time (s)0.375478
redirect count0
speed download83690
server IP 172.217.22.193
* all occurrences of the string "http://" have been changed to "htt???/"