If you are not sure if the website you would like to visit is secure, you can verify it here. Enter the website address of the page and see parts of its content and the thumbnail images on this site. None (if any) dangerous scripts on the referenced page will be executed. Additionally, if the selected site contains subpages, you can verify it (review) in batches containing 5 pages.
favicon.ico: misfitsims.wordpress.com - A Legacy of Misfits | "We.

site address: misfitsims.wordpress.com redirected to: misfitsims.wordpress.com

site title: A Legacy of Misfits "Welcome to the island of misfit toys"

Our opinion (on Monday 24 August 2026 14:34:12 UTC):

GREEN status (no comments) - no comments
After content analysis of this website we propose the following hashtags:



Meta tags:
description=misfit mɪsfɪt  noun - a person whose behaviour or attitude sets them apart from others in an uncomfortably conspicuous way Hello there ^_^ Thank you for stopping by at my blog because that probably means you re looking to read my legacy. So thank you :3 Anyway, welcome to the Hackett legacy, under the title of A Legacy of…;

Headings (most frequently used words):

of, home, recent, legacy, misfits, menu, thank, you, posts, comments, follow, these, lovelies, too, archives, categories, meta, welcome, to, the, island, misfit, toys, thoughts, on, share, this, leave, comment, cancel, reply,

Text of the page (most frequently used words):
the (71), #legacy (35), and (17), sims (16), 2014 (13), family (11), you (10), generation (10), chapter (10), story (9), for (9), blog (8), june (7), reply (7), says (6), this (5), wordpress (5), com (5), misfits (5), out (5), are (5), king (5), welcome (5), alphabetcy (5), first (5), rules (5), all (5), lotstar2703 (5), with (4), other (4), life (4), through (4), secrets (4), just (4), challenge (4), that (4), after (4), infinite (4), heir (4), thank (4), comment (3), comments (3), log (3), stories (3), isbi (3), our (3), better (3), left (3), 100 (3), baby (3), free (3), poses (3), lilyshadowwriter (3), hotel (3), new (3), thanks (3), your (3), will (3), home (3), share (3), her (3), briar (3), from (3), misfit (3), get (2), started (2), site (2), like (2), website (2), required (2), content (2), sign (2), subscribed (2), subscribe (2), have (2), account (2), now (2), where (2), don (2), dustland (2), fairytale (2), danevbie (2), plumbob (2), lovesstorms (2), drake (2), looking (2), supernatural (2), ravenwood (2), lake (2), todayintheworldofsimsstories (2), zale (2), shadows (2), woods (2), over (2), mod (2), finds (2), lives (2), chance (2), lizzielilyyy (2), secret (2), jewell (2), rue (2), spoone (2), postsecret (2), polychromeward (2), bound (2), colour (2), extraordinaire17 (2), gould (2), simm (2), bane (2), existence (2), breaking (2), small (2), world (2), colors (2), possibilites (2), lightning (2), sins (2), crowe (2), xavier (2), once (2), upon (2), grimm (2), next (2), different (2), winters (2), create (2), feed (2), follow (2), too (2), day (2), take (2), recent (2), keep (2), checking (2), read (2), work (2), scoring (2), thing (2), there (2), not (2), because (2), facebook (2), opens (2), window (2), away (2), about (2), hackett (2), links (2), each (2), list (2), probably (2), island (2), toys (2), design, name, email, write, loading, collapse, bar, manage, subscriptions, view, post, reader, report, copy, shortlink, privacy, already, join, subscribers, dreams, high, wind, blow, here, good, girls, die, sky, won, snow, seen, tale, things, then, came, right, place, another, fancy, sharing, one, million, views, counting, dont, let, lonely, tonight, very, written, rainbowacy, tigerlily, lotus, featuring, twists, turns, trials, tribulations, discover, true, never, been, shared, explore, surprising, behind, rainbow, ditft, generations, parfait, custom, alphabetacy, some, questions, unanswered, little, culture, anyone, really, needs, sum, choices, quick, trip, alphabet, style, man, dog, their, fantasy, differences, tree, entries, meta, uncategorized, specials, notes, polls, categories, april, may, july, august, september, october, archives, these, lovelies, two, vote, back, mind, posts, 161, hits, search, leave, cancel, ahh, plan, update, more, often, school, holidays, loving, far, posting, susan, boookmarked, meganmariethomas, yeah, whole, points, definitely, look, sim, found, forum, recently, doing, strict, either, bit, overwhelming, cheering, gen, simperatrix, thoughts, current, being, ignored, neglected, moves, sunset, valley, three, closest, friends, live, big, city, bridgeport, but, soon, learns, everything, perfect, independence, living, has, deal, drama, friendship, course, love, its, issues, lot, which, while, she, still, teenage, years, basically, need, know, going, see, beginning, click, banners, can, page, above, want, specific, should, mention, isn, typical, exactly, mainly, sticking, choose, minimal, cheats, possible, however, always, precedence, anyway, under, title, aka, attempt, publishing, full, proper, hello, stopping, means, mɪsfɪt, noun, person, whose, behaviour, attitude, sets, them, apart, others, uncomfortably, conspicuous, way, characters, heirs, credits, author, skip, menu,


Text of the page (random words):
a legacy of misfits welcome to the island of misfit toys a legacy of misfits welcome to the island of misfit toys menu skip to content home about the author chapter list credits heirs other characters other links home misfit mɪsfɪt noun a person whose behaviour or attitude sets them apart from others in an uncomfortably conspicuous way hello there _ thank you for stopping by at my blog because that probably means you re looking to read my legacy so thank you 3 anyway welcome to the hackett legacy under the title of a legacy of misfits aka my first attempt at publishing a full proper sims 3 story i should probably mention this isn t a typical legacy i don t exactly follow the rules and am mainly just sticking to the 10 generation choose an heir each generation thing with minimal cheats possible however story will always take precedence over the rules and that s basically all you need to know keep going to see links to the beginning of each generation click the banners or you can go to the chapter list page above if you want to go to a specific chapter the first and current generation briar hackett after a life of being ignored and neglected by her family briar moves away from sunset valley with her three closest friends to live in the big city of bridgeport but briar soon learns that not everything is perfect about independence and living away from family and has to deal with the drama of work friendship and of course love and all its issues a lot of which while she is still in her teenage years share this share on x opens in new window x share on facebook opens in new window facebook 6 thoughts on home simperatrix says june 8 2014 at 2 42 am hi there i found your blog through the ea forum my sims blog started just recently too not doing a strict legacy either because the rules and scoring get a bit overwhelming will be cheering on for you and gen 1 reply lotstar2703 says june 8 2014 at 3 07 am hi thanks for checking my legacy out yeah the whole scoring and points thing is just eh for me thank you for the comment and i ll definitely look at your sim blog reply meganmariethomas says june 26 2014 at 11 35 am boookmarked and will read after work reply lotstar2703 says june 27 2014 at 6 42 am thanks for checking it out reply susan says june 27 2014 at 2 11 am loving your story so far keep posting reply lotstar2703 says june 27 2014 at 6 43 am ahh thanks i do plan to update more often now i m on school holidays reply leave a comment cancel reply δ search thank you 6 161 hits recent posts chapter 2 2 hotel of the mind new story chapter 2 1 first day back generation 2 heir generation 2 heir vote recent comments lotstar2703 on chapter 2 2 hotel of t lotstar2703 on chapter 1 16 take two lilyshadowwriter on chapter 2 2 hotel of t lilyshadowwriter on chapter 2 1 first day lilyshadowwriter on chapter 1 19 for the r follow these lovelies too different winters the next generation once upon a grimm the legacy of the xavier s the sins of a crowe the lightning alphabetcy infinite colors infinite possibilites it s a small world after all breaking the rules bane of my existence the simm legacy the gould legacy extraordinaire17 s poses colour me free polychromeward bound postsecret rue spoone the 100 baby challenge the secret life of jewell the king family legacy lizzielilyyy s blog our lives are better left to chance sims 3 mod finds shadows in the woods zale family isbi alphabetcy todayintheworldofsimsstories the lake legacy the ravenwood legacy the drake family secrets lovesstorms stories welcome the king legacy through the plumbob the danevbie legacy dustland fairytale archives october 2014 september 2014 august 2014 july 2014 june 2014 may 2014 april 2014 categories generation 1 generation 2 heir polls notes specials uncategorized meta create account log in entries feed comments feed wordpress com create a free website or blog at wordpress com different winters a differences in the family tree challenge story the next generation once upon a grimm a sims 3 fantasy legacy the legacy of the xavier s a story of a man a dog and their legacy the sins of a crowe the lightning alphabetcy a quick trip through the alphabet sims 3 er sims 4 style infinite colors infinite possibilites we are the sum of our choices it s a small world after all a little culture is all anyone really needs breaking the rules a sims 3 story bane of my existence some questions are better left unanswered the simm legacy a sims 3 legacy story the gould legacy a sims 3 alphabetacy extraordinaire17 s poses custom poses for the sims 3 colour me free 10 generations of the parfait family polychromeward bound a rainbow ditft legacy postsecret discover true secrets that have never been shared explore the surprising stories behind the secrets rue spoone the 100 baby challenge a sims 3 100 baby challenge the secret life of jewell the king family legacy a sims 3 legacy featuring the twists turns trials and tribulations of the king family lizzielilyyy s blog my very first written legacy the rainbowacy of tigerlily lotus our lives are better left to chance dont let me be lonely tonight sims 3 mod finds over one million views and counting shadows in the woods a supernatural legacy zale family isbi alphabetcy a fancy blog sharing my isbi alphabetcy todayintheworldofsimsstories just another wordpress com site the lake legacy a sims 3 legacy like no other the ravenwood legacy looking for a tale of things supernatural then you came to the right place the drake family secrets a sims 3 legacy story lovesstorms stories welcome the king legacy through the plumbob life as seen by sims the danevbie legacy dustland fairytale out where the dreams are high out where the wind don t blow out here the good girls die and the sky won t snow subscribe subscribed a legacy of misfits join 39 other subscribers sign me up already have a wordpress com account log in now privacy a legacy of misfits subscribe subscribed sign up log in copy shortlink report this content view post in reader manage subscriptions collapse this bar loading comments write a comment email required name required website design a site like this with wordpress com get started
Thumbnail images (randomly selected): * Images may be subject to copyright.GREEN status (no comments)
  • Banner
  • simperatrix s avatar
  • lotstar2703 s avatar
  • SimMadMeg s avatar
  • Susan s avatar
  • lotstar2703 s avatar
  • LilyShadowWriter s avatar

Verified site has: 31 subpage(s). Do you want to verify them? Verify pages:

1-5 6-10 11-15 16-20 21-25 26-30 31-31


The site also has references to the 37 subdomain(s)

  simperatrix.wordpress.com  Verify   differentwinters.wordpress.com  Verify   thenextgenerationts4.wordpress.com  Verify
  onceuponagrimm.wordpress.com  Verify   thexavierlegacies.wordpress.com  Verify   thecrowelegacy.wordpress.com  Verify
  thelightningalphabetcy.wordpress.com  Verify   infinitecolorsinfinitepossibilities.wordpress.com  Verify   kulturalegacy.wordpress.com  Verify
  breakingtherulests3.wordpress.com  Verify   bomesims3.wordpress.com  Verify   thesimmlegacy.wordpress.com  Verify
  thegouldlegacy.wordpress.com  Verify   extraordinaire17.wordpress.com  Verify   deardiaryweneedtotalk.wordpress.com  Verify
  polychromewardbound.wordpress.com  Verify   postsecretdotcom.wordpress.com  Verify   ruespoone100babychallenge.wordpress.com  Verify
  thesecretlifeofjewell.wordpress.com  Verify   thesimsthreekingfamilylegacy.wordpress.com  Verify   tigerlilylotus.wordpress.com  Verify
  betterlefttochancelegacy.wordpress.com  Verify   sims3fixes.wordpress.com  Verify   parasimnal.wordpress.com  Verify
  hmmjames.wordpress.com  Verify   todayintheworldofsimsstories.wordpress.com  Verify   thelakelegacysims.wordpress.com  Verify
  theravenwoodlegacy.wordpress.com  Verify   thedrakefamilysecrets.wordpress.com  Verify   lovesstorms.wordpress.com  Verify
  shurasimsstories.wordpress.com  Verify   thekinglegacysims.wordpress.com  Verify   throughtheplumbob.wordpress.com  Verify
  serindeppity.wordpress.com  Verify   dustlandfairytalesims.wordpress.com  Verify   wordpress.com  Verify
  subscribe.wordpress.com  Verify


The site also has 2 references to external domain(s).

 ribbonjournals.blogspot.com  Verify  wp.me  Verify


Top 50 hastags from of all verified websites.

Supplementary Information (add-on for SEO geeks)*- See more on header.verify-www.com

Header

HTTP/1.1 301 Moved Permanently
Server nginx
Date Mon, 24 Aug 2026 14:34:11 GMT
Content-Type text/html
Content-Length 162
Connection keep-alive
Location htt????/misfitsims.wordpress.com/
Alt-Svc clear
Server-Timing a8c-cdn, dc;desc=cdg, cache;desc=BYPASS;dur=0.0
HTTP/2 200
server nginx
date Mon, 24 Aug 2026 14:34:11 GMT
content-type text/html; charset=UTF-8
vary Accept-Encoding
x-hacker Want root? Visit join.a8c.com/hacker and mention this header.
host-header WordPress.com
link <htt????/public-api.wordpress.com/wp-json/?rest_route=/sites/misfitsims.wordpress.com>; rel= htt????/api.w.org/
vary accept, content-type, cookie
x-pingback htt????/misfitsims.wordpress.com/xmlrpc.php
link <htt????/wp.me/P4rtHC-I>; rel=shortlink
content-encoding gzip
x-ac 13.cdg _dca MISS
alt-svc clear
strict-transport-security max-age=31536000
server-timing a8c-cdn, dc;desc=cdg, cache;desc=MISS;dur=565.0

Meta Tags

title="A Legacy of Misfits | "Welcome to the island of misfit toys""
charset="UTF-8"
name="viewport" content="width=device-width, initial-scale=1"
name="robots" content="max-image-preview:large"
name="generator" content="WordPress.com"
property="og:type" content="website"
property="og:title" content="A Legacy of Misfits"
property="og:description" content='"Welcome to the island of misfit toys"'
property="og:url" content="htt????/misfitsims.wordpress.com/"
property="og:site_name" content="A Legacy of Misfits"
property="og:image" content="htt????/misfitsims.wordpress.com/wp-content/uploads/2014/05/banner.jpg"
property="og:image:secure_url" content="htt????/misfitsims.wordpress.com/wp-content/uploads/2014/05/banner.jpg"
property="og:image:width" content="851"
property="og:image:height" content="315"
property="og:image:alt" content="Banner"
property="og:locale" content="en_US"
property="fb:app_id" content="249643311490"
property="article:publisher" content="htt????/www.facebook.com/WordPresscom"
name="twitter:text:title" content="Home"
name="twitter:image" content="htt????/misfitsims.wordpress.com/wp-content/uploads/2014/05/banner.jpg?w=640"
name="twitter:image:alt" content="Banner"
name="twitter:card" content="summary_large_image"
name="theme-color" content="#333333"
name="description" content="misfit 'mɪsfɪt' noun - a person whose behaviour or attitude sets them apart from others in an uncomfortably conspicuous way Hello there ^_^ Thank you for stopping by at my blog because that probably means you're looking to read my legacy. So thank you :3 Anyway, welcome to the Hackett legacy, under the title of "A Legacy of…"
id="bilmur" property="bilmur:data" content="" data-provider="wordpress.com" data-service="simple" data-site-tz="Etc/GMT-0" data-custom-props='{"logged_in":"0","wptheme":"pub\/expound","wptheme_is_block":"0"}'

Load Info

page size131862
load time (s)0.674065
redirect count1
speed download46884
server IP 192.0.78.12
* all occurrences of the string "http://" have been changed to "htt???/"